StarFunc result for job id O60543

User Input

>input (219 residues)
MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELIS
KTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSP
PKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYS
AQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N5P9	0.435	0.383	1.705E-35	253	0.945	0.818	Q8N5P9.pdb.gz	Q8N5P9_HUMAN Cell death activator CIDE-A variant 2 OS=Homo sapiens OX=9606 GN=CIDEA PE=1 SV=1
2	AFDB:O70302	0.648	0.653	7.332E-34	217	0.826	0.834	O70302.pdb.gz	CIDEA_MOUSE Lipid transferase CIDEA OS=Mus musculus OX=10090 GN=Cidea PE=1 SV=2
3	AFDB:Q96AQ7	0.407	0.384	4.290E-21	238	0.438	0.403	Q96AQ7.pdb.gz	CIDEC_HUMAN Lipid transferase CIDEC OS=Homo sapiens OX=9606 GN=CIDEC PE=1 SV=1
4	AFDB:P56198	0.453	0.418	2.168E-20	239	0.420	0.385	P56198.pdb.gz	CIDEC_MOUSE Lipid transferase CIDEC OS=Mus musculus OX=10090 GN=Cidec PE=1 SV=2
5	AFDB:Q9UHD4	0.385	0.385	6.591E-19	219	0.397	0.397	Q9UHD4.pdb.gz	CIDEB_HUMAN Lipid transferase CIDEB OS=Homo sapiens OX=9606 GN=CIDEB PE=1 SV=2
6	AFDB:D3ZKI3	0.281	0.249	1.179E-13	248	0.347	0.306	D3ZKI3.pdb.gz	D3ZKI3_RAT Cell death-inducing DFFA-like effector b OS=Rattus norvegicus OX=10116 GN=Cideb PE=4 SV=3
7	AFDB:A8DY77	0.358	0.146	3.125E-9	549	0.164	0.066	A8DY77.pdb.gz	A8DY77_DROME DNAation factor-related protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
8	AFDB:O54786	0.367	0.248	5.026E-8	331	0.237	0.157	O54786.pdb.gz	DFFA_MOUSE DNA fragmentation factor subunit alpha OS=Mus musculus OX=10090 GN=Dffa PE=1 SV=2
9	AFDB:O61464	0.348	0.258	1.130E-7	299	0.146	0.107	O61464.pdb.gz	O61464_DROME DNAation factor DREP-1 OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=1 SV=1
10	AFDB:Q0E9B7	0.373	0.312	2.016E-7	266	0.142	0.117	Q0E9B7.pdb.gz	Q0E9B7_DROME DNAation factor-related protein 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Drep3 PE=1 SV=1
11	PDB:3pgeA	0.283	0.350	4.624E-3	172	0.100	0.128	3pgeA.pdb.gz
12	PDB:5xqmA	0.267	0.579	5.501E-3	90	0.050	0.122	5xqmA.pdb.gz
13	PDB:7np7D1	0.232	0.121	9.260E-3	485	0.091	0.041	7np7D1.pdb.gz
14	PDB:6mdhA	0.272	0.388	1.854E-2	149	0.046	0.067	6mdhA.pdb.gz
15	PDB:6yvaC	0.279	0.382	2.206E-2	155	0.073	0.103	6yvaC.pdb.gz
16	PDB:3tixA	0.275	0.379	2.337E-2	153	0.059	0.085	3tixA.pdb.gz
17	PDB:4x57B	0.229	0.468	2.337E-2	93	0.055	0.129	4x57B.pdb.gz
18	PDB:5ia8A	0.288	0.621	2.477E-2	92	0.032	0.076	5ia8A.pdb.gz
19	PDB:7rbsB	0.281	0.381	2.781E-2	157	0.110	0.153	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
20	PDB:3plvA	0.266	0.618	2.946E-2	80	0.046	0.125	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60543	8.60e-165	454	219	1.000	1.000	CIDEA_HUMAN Lipid transferase CIDEA OS=Homo sapiens OX=9606 GN=CIDEA PE=1 SV=1
2	Q8N5P9	1.40e-153	427	253	0.945	0.818	Q8N5P9_HUMAN Cell death activator CIDE-A variant 2 OS=Homo sapiens OX=9606 GN=CIDEA PE=1 SV=1
3	O70302	2.67e-136	382	217	0.826	0.834	CIDEA_MOUSE Lipid transferase CIDEA OS=Mus musculus OX=10090 GN=Cidea PE=1 SV=2
4	Q96AQ7	1.55e-58	186	238	0.420	0.387	CIDEC_HUMAN Lipid transferase CIDEC OS=Homo sapiens OX=9606 GN=CIDEC PE=1 SV=1
5	P56198	2.09e-58	186	239	0.411	0.377	CIDEC_MOUSE Lipid transferase CIDEC OS=Mus musculus OX=10090 GN=Cidec PE=1 SV=2
6	O70303	6.24e-49	161	219	0.388	0.388	CIDEB_MOUSE Lipid transferase CIDEB OS=Mus musculus OX=10090 GN=Cideb PE=1 SV=2
7	Q9UHD4	2.00e-47	157	219	0.397	0.397	CIDEB_HUMAN Lipid transferase CIDEB OS=Homo sapiens OX=9606 GN=CIDEB PE=1 SV=2
8	D3ZKI3	2.23e-47	158	264	0.379	0.314	D3ZKI3_RAT Cell death-inducing DFFA-like effector b OS=Rattus norvegicus OX=10116 GN=Cideb PE=4 SV=3
9	A0A8I6ASG0	7.26e-44	147	206	0.342	0.364	A0A8I6ASG0_RAT Cell death-inducing DFFA-like effector b OS=Rattus norvegicus OX=10116 GN=Cideb PE=1 SV=1
10	Q498U6	3.56e-11	63.2	265	0.164	0.136	Q498U6_RAT DNA fragmentation factor subunit alpha OS=Rattus norvegicus OX=10116 GN=Dffa PE=1 SV=1
11	A0A0B4KFQ3	4.06e-11	63.5	306	0.137	0.098	A0A0B4KFQ3_DROME DNAation factor-related protein 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=4 SV=1
12	Q6NR36	4.17e-11	63.2	297	0.137	0.101	Q6NR36_DROME DNAation factor-related protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=2 SV=1
13	O61464	5.37e-11	62.8	299	0.137	0.100	O61464_DROME DNAation factor DREP-1 OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=1 SV=1
14	O54786	9.30e-11	62.4	331	0.155	0.103	DFFA_MOUSE DNA fragmentation factor subunit alpha OS=Mus musculus OX=10090 GN=Dffa PE=1 SV=2
15	A0A0B4KFF6	3.76e-10	61.2	497	0.132	0.058	A0A0B4KFF6_DROME DNAation factor-related protein 2, isoform D OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
16	A8DY77	5.02e-10	60.8	549	0.132	0.053	A8DY77_DROME DNAation factor-related protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
17	Q9U787	5.11e-10	60.5	481	0.132	0.060	Q9U787_DROME Drep2 OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
18	Q7K304	5.31e-10	60.5	482	0.132	0.060	Q7K304_DROME DNAation factor-related protein 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
19	O00273	1.01e-09	59.3	331	0.228	0.151	DFFA_HUMAN DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA PE=1 SV=1
20	Q0E9B7	4.20e-07	51.6	266	0.137	0.113	Q0E9B7_DROME DNAation factor-related protein 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Drep3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02017 CIDE-N	7.1e-26	101.4	CIDE-N domain
2	PF12518 DUF3721	1.9e+02	13.2	Protein of unknown function
3	PF01571 GCV_T	3.7e+02	11.7	Aminomethyltransferase folate-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320209

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262999	0.911	Mitochondrial brown fat uncoupling protein 1
2	9606.ENSP00000373328	0.890	Cell death activator CIDE-3
3	9606.ENSP00000270722	0.881	PR domain zinc finger protein 16
4	9606.ENSP00000359022	0.827	Elongation of very long chain fatty acids protein 3
5	9606.ENSP00000339524	0.823	DNA fragmentation factor subunit beta
6	9606.ENSP00000292907	0.818	Cytochrome c oxidase subunit 7A1, mitochondrial
7	9606.ENSP00000264867	0.815	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
8	9606.ENSP00000382237	0.810	Transmembrane protein 26
9	9606.ENSP00000450980	0.806	Responsible for the deiodination of T4 (3,5,3',5'- tetraiodothyronine)
10	9606.ENSP00000300055	0.777	Perilipin-1
11	9606.ENSP00000287820	0.720	Peroxisome proliferator-activated receptor gamma
12	9606.ENSP00000371272	0.713	Perilipin-5
13	9606.ENSP00000343782	0.706	Beta-3 adrenergic receptor
14	9606.ENSP00000256104	0.704	Fatty acid-binding protein, adipocyte
15	9606.ENSP00000389814	0.681	Adiponectin
16	9606.ENSP00000471477	0.669	Fibroblast growth factor 21
17	9606.ENSP00000379011	0.668	Carnitine O-palmitoyltransferase 1, muscle isoform
18	9606.ENSP00000385523	0.668	Peroxisome proliferator-activated receptor alpha
19	9606.ENSP00000337701	0.666	Patatin-like phospholipase domain-containing protein 2
20	9606.ENSP00000244289	0.658	Hormone-sensitive lipase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.942	identical protein binding
GO:0046983	0.563	protein dimerization activity
GO:0042803	0.529	protein homodimerization activity
GO:0003824	0.340	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0009987	0.984	cellular process
GO:0009894	0.944	regulation of catabolic process
GO:0080090	0.940	regulation of primary metabolic process
GO:0019216	0.916	regulation of lipid metabolic process
GO:0048519	0.903	negative regulation of biological process
GO:0060255	0.892	regulation of macromolecule metabolic process
GO:0050994	0.884	regulation of lipid catabolic process
GO:0050794	0.854	regulation of cellular process
GO:0051239	0.820	regulation of multicellular organismal process
GO:0009892	0.818	negative regulation of metabolic process
GO:0001817	0.780	regulation of cytokine production
GO:0009895	0.776	negative regulation of catabolic process
GO:0008152	0.773	metabolic process
GO:1903555	0.749	regulation of tumor necrosis factor superfamily cytokine production
GO:0010605	0.687	negative regulation of macromolecule metabolic process
GO:0045833	0.624	negative regulation of lipid metabolic process
GO:0001818	0.608	negative regulation of cytokine production
GO:0071704	0.590	organic substance metabolic process
GO:0044238	0.559	primary metabolic process
GO:0050896	0.502	response to stimulus
GO:0031323	0.467	regulation of cellular metabolic process
GO:0048518	0.464	positive regulation of biological process
GO:1903556	0.421	negative regulation of tumor necrosis factor superfamily cytokine production
GO:0051171	0.418	regulation of nitrogen compound metabolic process
GO:0048523	0.348	negative regulation of cellular process
GO:0051716	0.337	cellular response to stimulus
GO:0044237	0.329	cellular metabolic process
GO:0009893	0.309	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005829	0.980	cytosol
GO:0070013	0.968	intracellular organelle lumen
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0005811	0.903	lipid droplet
GO:0005634	0.799	nucleus
GO:0016020	0.407	membrane
GO:0005739	0.384	mitochondrion
GO:0031981	0.374	nuclear lumen
GO:0012505	0.345	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]