StarFunc result for job id O60547

User Input

>input (372 residues)
MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSF
NTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDL
AEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYG
AAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSL
GNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEG
KNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVH
ADVELMRTNPNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60547	1.000	1.000	6.899E-81	372	1.000	1.000	O60547.pdb.gz	GMDS_HUMAN GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS PE=1 SV=1
2	PDB:5in4A	0.939	0.984	1.561E-74	355	0.941	0.986	5in4A.pdb.gz	Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.
3	AFDB:A7BI56	0.949	0.937	1.102E-72	377	0.823	0.812	A7BI56.pdb.gz
4	AFDB:Q9VMW9	0.946	0.891	6.480E-66	395	0.677	0.638	Q9VMW9.pdb.gz	GMDS_DROME GDP-mannose 4,6 dehydratase OS=Drosophila melanogaster OX=7227 GN=Gmd PE=1 SV=2
5	AFDB:Q18801	0.935	0.872	5.075E-63	399	0.632	0.589	Q18801.pdb.gz	GMD1_CAEEL GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis elegans OX=6239 GN=bre-1 PE=1 SV=3
6	AFDB:O45583	0.932	0.908	8.191E-62	382	0.632	0.615	O45583.pdb.gz	GMD2_CAEEL GDP-mannose 4,6 dehydratase 2 OS=Caenorhabditis elegans OX=6239 GN=gmd-2 PE=1 SV=1
7	AFDB:Q1ZXF7	0.915	0.956	2.075E-57	356	0.608	0.635	Q1ZXF7.pdb.gz	GMDS_DICDI GDP-mannose 4,6 dehydratase OS=Dictyostelium discoideum OX=44689 GN=gmd PE=1 SV=1
8	AFDB:P0AC88	0.915	0.912	9.362E-57	373	0.565	0.563	P0AC88.pdb.gz	GM4D_ECOLI GDP-mannose 4,6-dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=gmd PE=1 SV=1
9	AFDB:Q387W4	0.913	0.938	4.288E-55	362	0.508	0.522	Q387W4.pdb.gz	Q387W4_TRYB2 GDP-mannose 4,6-dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0880 PE=3 SV=1
10	AFDB:Q72EX0	0.902	0.881	6.816E-55	381	0.565	0.551	Q72EX0.pdb.gz	Q72EX0_DESVH GDP-mannose 4,6-dehydratase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=gmd PE=1 SV=1
11	AFDB:Q8IAX4	0.892	0.929	9.947E-53	357	0.503	0.524	Q8IAX4.pdb.gz	Q8IAX4_PLAF7 GDP-mannose 4,6-dehydratase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0813800 PE=3 SV=1
12	PDB:1n7gB	0.846	0.935	3.275E-48	336	0.516	0.571	1n7gB.pdb.gz	The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.
13	PDB:1rpnD	0.839	0.967	3.577E-46	322	0.438	0.506	1rpnD.pdb.gz	Crystal structure of a tetrameric GDP-D-mannose 4,6-dehydratase from a bacterial GDP-D-rhamnose biosynthetic pathway.
14	PDB:1db3A	0.799	0.883	6.386E-46	335	0.532	0.591	1db3A.pdb.gz
15	PDB:2pk3A	0.775	0.928	1.184E-31	309	0.242	0.291	2pk3A.pdb.gz	The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.
16	PDB:6lttA	0.754	0.894	8.513E-27	311	0.215	0.257	6lttA.pdb.gz
17	PDB:1keuA	0.771	0.794	2.639E-24	361	0.202	0.208	1keuA.pdb.gz	Toward a structural understanding of the dehydratase mechanism.
18	PDB:6k0gA	0.740	0.815	5.289E-24	335	0.210	0.233	6k0gA.pdb.gz	Structural basis for broad substrate specificity of UDP-glucose 4-epimerase in the human milk oligosaccharide catabolic pathway of Bifidobacterium longum.
19	PDB:6x3bA	0.694	0.850	2.386E-23	300	0.191	0.237	6x3bA.pdb.gz	X-ray crystallographic structure of RMD, the reductase involved in GDP-d-rhamnose production
20	PDB:4lisA	0.733	0.748	1.016E-22	364	0.202	0.206	4lisA.pdb.gz	Elucidation of Substrate Specificity in Aspergillus nidulans UDP-Galactose-4-Epimerase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QPT3	0.0	645	377	0.825	0.814	F1QPT3_DANRE GDP-mannose 4,6-dehydratase OS=Danio rerio OX=7955 GN=dZ84G17.1 PE=1 SV=1
2	O60547	0.0	779	372	1.000	1.000	GMDS_HUMAN GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS PE=1 SV=1
3	Q1LVF8	0.0	654	370	0.828	0.832	Q1LVF8_DANRE GDP-mannose 4,6-dehydratase OS=Danio rerio OX=7955 GN=S-GMDS PE=1 SV=1
4	Q9VMW9	0.0	545	395	0.683	0.643	GMDS_DROME GDP-mannose 4,6 dehydratase OS=Drosophila melanogaster OX=7227 GN=Gmd PE=1 SV=2
5	Q18801	1.12e-177	501	399	0.642	0.599	GMD1_CAEEL GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis elegans OX=6239 GN=bre-1 PE=1 SV=3
6	O45583	2.47e-175	494	382	0.632	0.615	GMD2_CAEEL GDP-mannose 4,6 dehydratase 2 OS=Caenorhabditis elegans OX=6239 GN=gmd-2 PE=1 SV=1
7	Q1ZXF7	1.70e-166	471	356	0.613	0.640	GMDS_DICDI GDP-mannose 4,6 dehydratase OS=Dictyostelium discoideum OX=44689 GN=gmd PE=1 SV=1
8	P0AC88	9.80e-154	439	373	0.565	0.563	GM4D_ECOLI GDP-mannose 4,6-dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=gmd PE=1 SV=1
9	Q72EX0	7.63e-151	432	381	0.567	0.554	Q72EX0_DESVH GDP-mannose 4,6-dehydratase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=gmd PE=1 SV=1
10	P72586	9.35e-146	419	362	0.543	0.558	P72586_SYNY3 GDP-mannose 4,6-dehydratase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=rfbD PE=1 SV=1
11	Q9SNY3	7.79e-143	411	361	0.524	0.540	GMD1_ARATH GDP-mannose 4,6 dehydratase 1 OS=Arabidopsis thaliana OX=3702 GN=GMD1 PE=1 SV=1
12	P93031	1.60e-138	400	373	0.527	0.525	GMD2_ARATH GDP-mannose 4,6 dehydratase 2 OS=Arabidopsis thaliana OX=3702 GN=MUR1 PE=1 SV=3
13	Q387W4	1.20e-137	398	362	0.513	0.528	Q387W4_TRYB2 GDP-mannose 4,6-dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0880 PE=3 SV=1
14	Q8IAX4	1.41e-131	382	357	0.505	0.527	Q8IAX4_PLAF7 GDP-mannose 4,6-dehydratase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0813800 PE=3 SV=1
15	P71790	3.85e-130	378	340	0.516	0.565	P71790_MYCTU GDP-mannose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gmdA PE=1 SV=2
16	Q51366	1.23e-104	313	323	0.438	0.505	GM4D_PSEAE GDP-mannose 4,6-dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=gmd PE=1 SV=2
17	Q6T1X6	1.01e-32	126	309	0.263	0.317	RMD_ANETH GDP-6-deoxy-D-mannose reductase OS=Aneurinibacillus thermoaerophilus OX=143495 GN=rmd PE=1 SV=1
18	F4JAG3	1.16e-16	83.2	458	0.263	0.214	F4JAG3_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
19	P9WN67	4.27e-16	80.5	314	0.159	0.188	GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=galE1 PE=1 SV=1
20	Q8VZC0	3.90e-15	78.6	435	0.245	0.209	UXS1_ARATH UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01370 Epimerase	4.7e-71	250.6	NAD dependent epimerase/dehydratase family
2	PF16363 GDP_Man_Dehyd	5.5e-159	540.6	GDP-mannose 4,6 dehydratase
3	PF05368 NmrA	9	17.3	NmrA-like family
4	PF02719 Polysacc_synt_2	5.7	17.6	Polysaccharide biosynthesis protein
5	PF04321 RmlD_sub_bind	0.0056	27.4	RmlD substrate binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370194

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398803	0.998	GDP-L-fucose synthase
2	9606.ENSP00000350949	0.927	Mannose-1-phosphate guanyltransferase alpha
3	9606.ENSP00000311579	0.861	Tankyrase-1
4	9606.ENSP00000360644	0.858	Dolichol-phosphate mannosyltransferase subunit 1
5	9606.ENSP00000322181	0.846	Dolichol phosphate-mannose biosynthesis regulatory protein
6	9606.ENSP00000262374	0.844	Chitobiosyldiphosphodolichol beta-mannosyltransferase
7	9606.ENSP00000410689	0.841	Actin filament-associated protein 1
8	9606.ENSP00000353910	0.819	Alpha-(1,6)-fucosyltransferase
9	9606.ENSP00000288078	0.811	L-fucose kinase
10	9606.ENSP00000357384	0.804	Dolichol-phosphate mannosyltransferase subunit 3
11	9606.ENSP00000359935	0.799	Fucose-1-phosphate guanylyltransferase
12	9606.ENSP00000319501	0.798	UDP-glucose 6-dehydrogenase
13	9606.ENSP00000281317	0.789	Methylmalonic aciduria type A protein, mitochondrial
14	9606.ENSP00000230449	0.762	Exocyst complex component 2
15	9606.ENSP00000370256	0.743	Forkhead box protein C1
16	9606.ENSP00000259806	0.737	Forkhead box protein F2
17	9606.ENSP00000296839	0.733	Forkhead box protein Q1
18	9606.ENSP00000257181	0.722	Pre-mRNA-splicing factor 38A
19	9606.ENSP00000483375	0.718	UDP-glucose 4-epimerase
20	9606.ENSP00000457788	0.715	Alpha-mannosidase 2C1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016836	0.995	hydro-lyase activity
GO:0005488	0.989	binding
GO:0005515	0.963	protein binding
GO:0008446	0.702	GDP-mannose 4,6-dehydratase activity
GO:0036094	0.695	small molecule binding
GO:0016757	0.637	glycosyltransferase activity
GO:0097159	0.609	organic cyclic compound binding
GO:0016758	0.462	hexosyltransferase activity
GO:1901363	0.371	heterocyclic compound binding
GO:0008417	0.305	fucosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044238	0.997	primary metabolic process
GO:0009226	0.990	nucleotide-sugar biosynthetic process
GO:0006793	0.944	phosphorus metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:1903561	0.966	extracellular vesicle
GO:0043229	0.964	intracellular organelle
GO:0070062	0.961	extracellular exosome
GO:0005829	0.959	cytosol
GO:0043231	0.884	intracellular membrane-bounded organelle
GO:0043233	0.357	organelle lumen
GO:0070013	0.353	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.2.1.-	0.995	Hydro-lyases.
RHEA:23820	0.702	GDP-alpha-D-mannose = GDP-4-dehydro-alpha-D-rhamnose + H2O
EC:4.2.1.47	0.702	GDP-mannose 4,6-dehydratase.
EC:2.4.-.-	0.637	Glycosyltransferases.
EC:2.4.1.-	0.462	Hexosyltransferases.

[back to server]