StarFunc result for job id O60548

User Input

>input (495 residues)
MTLGSCCCEIMSSESSPAALSEADADIDVVGGGSGGGELPARSGPRAPRDVLPHGHEPPA
EEAEADLAEDEEESGGCSDGEPRALASRGAAAAAGSPGPGAAAARGAAGPGPGPPSGGAA
TRSPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLS
LNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLPPPHPHPHPHPE
LLLRGGAAAAGDPGAFLPGFAAYGAYGYGYGLALPAYGAPPPGPAPHPHPHPHAFAFAAA
AAAAPCQLSVPPGRAAAPPPGPPTASVFAGAGSAPAPAPASGSGPGPGPAGLPAFLGAEL
GCAKAFYAASLSPPAAGTAAGLPTALLRQGLKTDAGGGAGGGGAGAGQRPSFSIDHIMGH
GGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSG
SRFASKVAGLSGCHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60548	0.999	0.999	5.721E-72	495	1.000	1.000	O60548.pdb.gz	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
2	AFDB:Q12948	0.203	0.182	6.316E-18	553	0.317	0.284	Q12948.pdb.gz	FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3
3	AFDB:O73779	0.211	0.348	1.364E-16	297	0.208	0.347	O73779.pdb.gz	O73779_DANRE Fork head domain protein FKD3 OS=Danio rerio OX=7955 GN=foxb1.2 PE=2 SV=1
4	AFDB:Q9C009	0.185	0.225	3.135E-16	403	0.275	0.337	Q9C009.pdb.gz	FOXQ1_HUMAN Forkhead box protein Q1 OS=Homo sapiens OX=9606 GN=FOXQ1 PE=2 SV=2
5	AFDB:Q8MIP2	0.239	0.306	3.342E-16	377	0.261	0.342	Q8MIP2.pdb.gz	FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus OX=9925 GN=FOXL2 PE=1 SV=1
6	AFDB:Q6P0C9	0.210	0.243	4.318E-16	427	0.220	0.255	Q6P0C9.pdb.gz	Q6P0C9_DANRE Forkhead box A1 OS=Danio rerio OX=7955 GN=fkd7 PE=2 SV=1
7	AFDB:Q12952	0.202	0.286	1.553E-15	345	0.228	0.328	Q12952.pdb.gz	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
8	AFDB:O43638	0.216	0.321	2.946E-15	330	0.228	0.342	O43638.pdb.gz	FOXS1_HUMAN Forkhead box protein S1 OS=Homo sapiens OX=9606 GN=FOXS1 PE=2 SV=2
9	AFDB:Q64731	0.217	0.312	2.946E-15	336	0.242	0.357	Q64731.pdb.gz	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
10	AFDB:Q9W707	0.198	0.260	5.241E-15	372	0.228	0.304	Q9W707.pdb.gz	FXF1B_XENLA Forkhead box protein F1-B OS=Xenopus laevis OX=8355 GN=foxf1-b PE=2 SV=1
11	PDB:2hdcA	0.168	0.681	5.514E-12	97	0.184	0.938	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:5k1yD	0.109	0.466	2.443E-2	92	0.038	0.207	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
13	PDB:2nyxB	0.098	0.292	6.383E-2	147	0.020	0.068	2nyxB.pdb.gz
14	PDB:3euhB	0.144	0.211	8.790E-2	321	0.026	0.040	3euhB.pdb.gz
15	PDB:7k5yU	0.128	0.669	1.065E-1	75	0.030	0.200	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
16	PDB:5h3rA	0.116	0.359	1.376E-1	141	0.022	0.078	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
17	PDB:2fe3B	0.112	0.344	1.467E-1	143	0.018	0.063	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
18	PDB:4a6dA	0.114	0.159	1.467E-1	345	0.018	0.026	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
19	PDB:7dn3O	0.122	0.135	1.467E-1	443	0.032	0.036	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
20	PDB:5hs7A	0.107	0.409	1.777E-1	102	0.024	0.118	5hs7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60548	0.0	942	495	1.000	1.000	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
2	Q61345	7.75e-66	221	456	0.253	0.274	FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus OX=10090 GN=Foxd1 PE=2 SV=2
3	Q9PSY4	5.65e-64	213	345	0.248	0.357	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
4	F1R5S7	4.60e-63	211	371	0.275	0.367	F1R5S7_DANRE Forkhead box protein D3 OS=Danio rerio OX=7955 GN=fkd-6 PE=1 SV=1
5	Q16676	1.11e-62	213	465	0.216	0.230	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
6	Q9DEN4	8.86e-60	202	371	0.220	0.294	FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis OX=8355 GN=foxd3-a PE=1 SV=1
7	Q12950	2.00e-59	204	439	0.208	0.235	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
8	P79772	9.06e-59	201	394	0.236	0.297	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
9	Q9DEN3	1.43e-58	199	371	0.216	0.288	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
10	Q61060	1.45e-58	202	465	0.242	0.258	FOXD3_MOUSE Forkhead box protein D3 OS=Mus musculus OX=10090 GN=Foxd3 PE=2 SV=3
11	Q9UJU5	4.70e-56	196	478	0.172	0.178	FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens OX=9606 GN=FOXD3 PE=1 SV=1
12	Q18694	9.34e-55	188	333	0.162	0.240	UN130_CAEEL Forkhead box protein unc-130 OS=Caenorhabditis elegans OX=6239 GN=unc-130 PE=1 SV=1
13	Q9PRJ8	9.74e-55	189	352	0.170	0.239	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
14	Q63245	1.04e-54	180	101	0.172	0.842	FOXD3_RAT Forkhead box protein D3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd3 PE=1 SV=1
15	Q9PT68	7.04e-54	186	353	0.170	0.238	FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis OX=8355 GN=foxd5-b PE=2 SV=1
16	O73784	7.71e-53	183	321	0.166	0.255	O73784_DANRE Fork head domain protein FKD8 OS=Danio rerio OX=7955 GN=fkd8 PE=2 SV=1
17	Q6VB84	7.73e-51	180	417	0.208	0.247	FX4L3_HUMAN Forkhead box protein D4-like 3 OS=Homo sapiens OX=9606 GN=FOXD4L3 PE=1 SV=2
18	Q3SYB3	7.97e-51	180	417	0.208	0.247	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
19	Q9NU39	1.15e-50	179	408	0.208	0.252	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
20	Q8WXT5	1.44e-50	179	416	0.208	0.248	FX4L4_HUMAN Forkhead box protein D4-like 4 OS=Homo sapiens OX=9606 GN=FOXD4L4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	4e-34	127.9	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335493

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304502	0.575	Homeobox protein SIX2
2	9606.ENSP00000265807	0.528	SH2 domain-containing protein 4A
3	9606.ENSP00000381486	0.525	Homeobox protein notochord

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.999	protein binding
GO:0001228	0.996	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000976	0.919	transcription cis-regulatory region binding
GO:0000977	0.582	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.524	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.321	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0010468	0.940	regulation of gene expression
GO:0080090	0.930	regulation of primary metabolic process
GO:0031323	0.919	regulation of cellular metabolic process
GO:0019219	0.912	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.903	regulation of DNA-templated transcription
GO:0048518	0.870	positive regulation of biological process
GO:0048522	0.857	positive regulation of cellular process
GO:0006357	0.849	regulation of transcription by RNA polymerase II
GO:0010604	0.839	positive regulation of macromolecule metabolic process
GO:0051173	0.806	positive regulation of nitrogen compound metabolic process
GO:0045935	0.776	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.767	positive regulation of DNA-templated transcription
GO:0009987	0.749	cellular process
GO:0032501	0.640	multicellular organismal process
GO:0048856	0.632	anatomical structure development
GO:0007275	0.619	multicellular organism development
GO:0045944	0.583	positive regulation of transcription by RNA polymerase II
GO:0048731	0.410	system development
GO:0048523	0.393	negative regulation of cellular process
GO:0009892	0.347	negative regulation of metabolic process
GO:0051172	0.344	negative regulation of nitrogen compound metabolic process
GO:0010605	0.343	negative regulation of macromolecule metabolic process
GO:0031324	0.301	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.946	nuclear lumen
GO:0043232	0.920	intracellular non-membrane-bounded organelle
GO:0005654	0.343	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]