StarFunc result for job id O60563

User Input

>input (726 residues)
MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTIN
TAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPD
TRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN
SLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLM
SMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGV
DHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY
AAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEI
KMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNK
RPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSL
NFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDT
VNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPP
LPPLPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60563	1.000	1.000	6.755E-78	726	1.000	1.000	O60563.pdb.gz	CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1
2	AFDB:D3ZC98	0.306	0.333	1.700E-56	663	0.813	0.890	D3ZC98.pdb.gz	D3ZC98_RAT Cyclin T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=3 SV=1
3	AFDB:O60583	0.347	0.345	1.482E-34	730	0.470	0.467	O60583.pdb.gz	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
4	AFDB:Q7TQK0	0.346	0.347	2.819E-34	723	0.452	0.454	Q7TQK0.pdb.gz	CCNT2_MOUSE Cyclin-T2 OS=Mus musculus OX=10090 GN=Ccnt2 PE=1 SV=1
5	PDB:6gzhB	0.342	0.979	9.647E-28	252	0.340	0.980	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
6	AFDB:O96433	0.335	0.224	6.195E-25	1097	0.321	0.212	O96433.pdb.gz	CCNT_DROME Cyclin-T OS=Drosophila melanogaster OX=7227 GN=CycT PE=1 SV=2
7	AFDB:Q8GYM6	0.325	0.433	7.799E-16	541	0.168	0.226	Q8GYM6.pdb.gz	CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-4 PE=1 SV=1
8	PDB:7kpvB	0.248	0.592	1.938E-7	290	0.066	0.166	7kpvB.pdb.gz
9	PDB:5hbhB	0.278	0.710	1.391E-6	270	0.079	0.211	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
10	PDB:1zp2A	0.243	0.727	1.723E-6	227	0.045	0.145	1zp2A.pdb.gz
11	PDB:7jv7B	0.282	0.625	2.135E-6	310	0.051	0.119	7jv7B.pdb.gz
12	PDB:7kueB	0.233	0.682	1.363E-4	225	0.062	0.200	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
13	PDB:5iy7M	0.121	0.274	2.279E-4	310	0.039	0.090	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
14	PDB:7egb9	0.223	0.504	2.592E-4	287	0.070	0.178	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:7nj0C	0.231	0.586	3.652E-4	270	0.040	0.107	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
16	PDB:7b5lY	0.245	0.655	4.929E-4	253	0.062	0.178	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
17	AFDB:Q86R99	0.069	0.065	1.528E-1	797	0.120	0.109	Q86R99.pdb.gz	Q86R99_DROME Myosin phosphatase DMBS-S OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
18	AFDB:Q5TZF1	0.054	0.030	2.152E-1	2196	0.136	0.045	Q5TZF1.pdb.gz
19	AFDB:A0A2R8Q685	0.082	0.076	2.448E-1	834	0.109	0.095	A0A2R8Q685.pdb.gz	A0A2R8Q685_DANRE Potassium voltage-gated channel subfamily B member 1 OS=Danio rerio OX=7955 GN=kcnb1 PE=3 SV=1
20	AFDB:Q54LJ4	0.090	0.037	3.757E-1	2563	0.139	0.039	Q54LJ4.pdb.gz	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JXM2	0.0	1222	724	0.882	0.884	A0A0G2JXM2_RAT Cyclin-T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=1 SV=2
2	D3ZC98	0.0	992	663	0.766	0.839	D3ZC98_RAT Cyclin T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=3 SV=1
3	O60563	0.0	1508	726	1.000	1.000	CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1
4	Q9QWV9	0.0	1207	724	0.872	0.874	CCNT1_MOUSE Cyclin-T1 OS=Mus musculus OX=10090 GN=Ccnt1 PE=1 SV=3
5	Q7TQK0	8.29e-176	522	723	0.471	0.473	CCNT2_MOUSE Cyclin-T2 OS=Mus musculus OX=10090 GN=Ccnt2 PE=1 SV=1
6	O60583	3.17e-165	495	730	0.398	0.396	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
7	A0A8I6G622	3.57e-112	338	181	0.220	0.884	A0A8I6G622_RAT Cyclin T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=1 SV=1
8	O96433	3.65e-104	345	1097	0.227	0.150	CCNT_DROME Cyclin-T OS=Drosophila melanogaster OX=7227 GN=CycT PE=1 SV=2
9	G3V5E1	6.40e-40	153	378	0.113	0.217	G3V5E1_HUMAN Cyclin K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=1
10	Q8GYM6	9.16e-40	156	541	0.124	0.166	CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-4 PE=1 SV=1
11	O88874	1.07e-39	156	554	0.112	0.146	CCNK_MOUSE Cyclin-K OS=Mus musculus OX=10090 GN=Ccnk PE=1 SV=3
12	O75909	3.41e-39	155	580	0.112	0.140	CCNK_HUMAN Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2
13	F1QMB9	1.91e-38	150	425	0.110	0.188	CCNK_DANRE Cyclin-K OS=Danio rerio OX=7955 GN=ccnk PE=2 SV=3
14	Q961D1	6.30e-37	145	400	0.107	0.195	Q961D1_DROME Cyclin K, isoform A OS=Drosophila melanogaster OX=7227 GN=CycK PE=1 SV=1
15	F4KD43	2.52e-36	147	590	0.124	0.153	F4KD43_ARATH Cyclin family protein OS=Arabidopsis thaliana OX=3702 GN=CYCT1:5 PE=1 SV=1
16	G3V2Q3	1.31e-35	136	227	0.102	0.326	G3V2Q3_HUMAN Cyclin K (Fragment) OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=1
17	Q8LBC0	3.38e-32	129	317	0.112	0.256	CCT13_ARATH Cyclin-T1-3 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-3 PE=1 SV=2
18	P34425	3.42e-31	130	468	0.110	0.171	CCNT1_CAEEL Cyclin-T1.1 OS=Caenorhabditis elegans OX=6239 GN=cit-1.1 PE=3 SV=1
19	P34424	9.30e-29	124	555	0.098	0.128	CCNT2_CAEEL Cyclin-T1.2 OS=Caenorhabditis elegans OX=6239 GN=cit-1.2 PE=3 SV=2
20	Q8RWV3	2.56e-27	117	416	0.095	0.166	CCL11_ARATH Cyclin-L1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCL1-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00134 Cyclin_N	2.2e-16	71.2	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261900

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265343	0.999	AF4/FMR2 family member 4
2	9606.ENSP00000328773	0.999	Protein HEXIM1
3	9606.ENSP00000362361	0.999	Cyclin-dependent kinase 9
4	9606.ENSP00000263377	0.998	Bromodomain-containing protein 4
5	9606.ENSP00000378578	0.994	AF4/FMR2 family member 1
6	9606.ENSP00000463058	0.989	RNA-binding protein 8A
7	9606.ENSP00000256443	0.987	Cyclin-dependent kinase 7
8	9606.ENSP00000256897	0.979	Cyclin-H
9	9606.ENSP00000422626	0.978	La-related protein 7
10	9606.ENSP00000266970	0.976	Cyclin-dependent kinase 2
11	9606.ENSP00000479618	0.976	Myc proto-oncogene protein
12	9606.ENSP00000369695	0.972	Protein AF-9
13	9606.ENSP00000378699	0.971	Cyclin-dependent kinase 1
14	9606.ENSP00000470252	0.968	Transcription elongation factor SPT5
15	9606.ENSP00000308546	0.962	7SK snRNA methylphosphate capping enzyme
16	9606.ENSP00000261245	0.957	CDK-activating kinase assembly factor MAT1
17	9606.ENSP00000274026	0.955	Cyclin-A2
18	9606.ENSP00000262809	0.953	RNA polymerase II elongation factor ELL
19	9606.ENSP00000480158	0.949	DNA-directed RNA polymerase II subunit RPB1
20	9606.ENSP00000257904	0.948	Cyclin-dependent kinase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0003677	0.999	DNA binding
GO:0017069	0.999	snRNA binding
GO:0016538	0.992	cyclin-dependent protein serine/threonine kinase regulator activity
GO:0070063	0.990	RNA polymerase binding
GO:0008134	0.977	transcription factor binding
GO:0019887	0.957	protein kinase regulator activity
GO:0019209	0.955	kinase activator activity
GO:0043539	0.947	protein serine/threonine kinase activator activity
GO:0061575	0.938	cyclin-dependent protein serine/threonine kinase activator activity
GO:0140297	0.917	DNA-binding transcription factor binding
GO:0060090	0.916	molecular adaptor activity
GO:0140693	0.907	molecular condensate scaffold activity
GO:0003682	0.778	chromatin binding
GO:0097322	0.753	7SK snRNA binding
GO:0019900	0.726	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.976	regulation of cellular process
GO:0019222	0.950	regulation of metabolic process
GO:0048518	0.945	positive regulation of biological process
GO:0008152	0.941	metabolic process
GO:0071704	0.932	organic substance metabolic process
GO:0060255	0.931	regulation of macromolecule metabolic process
GO:0044237	0.928	cellular metabolic process
GO:0031323	0.925	regulation of cellular metabolic process
GO:0048522	0.922	positive regulation of cellular process
GO:0010468	0.920	regulation of gene expression
GO:0044238	0.918	primary metabolic process
GO:0051252	0.918	regulation of RNA metabolic process
GO:0006807	0.898	nitrogen compound metabolic process
GO:0010556	0.886	regulation of macromolecule biosynthetic process
GO:0031326	0.886	regulation of cellular biosynthetic process
GO:0043170	0.874	macromolecule metabolic process
GO:0006355	0.871	regulation of DNA-templated transcription
GO:0009893	0.867	positive regulation of metabolic process
GO:0010604	0.858	positive regulation of macromolecule metabolic process
GO:0051173	0.838	positive regulation of nitrogen compound metabolic process
GO:0031325	0.836	positive regulation of cellular metabolic process
GO:0034641	0.823	cellular nitrogen compound metabolic process
GO:0050896	0.799	response to stimulus
GO:0090304	0.784	nucleic acid metabolic process
GO:0045935	0.772	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.749	regulation of transcription by RNA polymerase II
GO:0051254	0.743	positive regulation of RNA metabolic process
GO:0065009	0.718	regulation of molecular function
GO:0016070	0.715	RNA metabolic process
GO:0010467	0.710	gene expression
GO:0045893	0.672	positive regulation of DNA-templated transcription
GO:0006366	0.632	transcription by RNA polymerase II
GO:0045944	0.602	positive regulation of transcription by RNA polymerase II
GO:1901564	0.493	organonitrogen compound metabolic process
GO:0043412	0.492	macromolecule modification
GO:0051246	0.488	regulation of protein metabolic process
GO:0036211	0.468	protein modification process
GO:0050790	0.364	regulation of catalytic activity
GO:0031399	0.313	regulation of protein modification process
GO:0051726	0.305	regulation of cell cycle
GO:0032784	0.305	regulation of DNA-templated transcription elongation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008023	1.000	transcription elongation factor complex
GO:0032806	0.999	carboxy-terminal domain protein kinase complex
GO:0019908	0.999	nuclear cyclin-dependent protein kinase holoenzyme complex
GO:0005829	0.987	cytosol
GO:0008024	0.691	cyclin/CDK positive transcription elongation factor complex
GO:0070691	0.373	P-TEFb complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]