StarFunc result for job id O60565

User Input

>input (184 residues)
MSRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGR
GQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYG
QCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCIS
IDLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35793	0.542	0.542	4.888E-23	184	0.984	0.984	O35793.pdb.gz	GREM1_RAT Gremlin-1 OS=Rattus norvegicus OX=10116 GN=Grem1 PE=1 SV=1
2	AFDB:R0KDQ4	0.537	0.537	1.128E-21	184	0.815	0.815	R0KDQ4.pdb.gz	R0KDQ4_ANAPL Gremlin 1, DAN family BMP antagonist (Fragment) OS=Anas platyrhynchos OX=8839 GN=GREM1 PE=3 SV=1
3	AFDB:O73754	0.534	0.540	2.757E-20	182	0.826	0.835	O73754.pdb.gz	GREM1_XENLA Gremlin-1 OS=Xenopus laevis OX=8355 GN=grem1 PE=2 SV=1
4	AFDB:A0A0B5JK45	0.538	0.594	7.117E-16	166	0.484	0.536	A0A0B5JK45.pdb.gz
5	AFDB:O88273	0.560	0.611	3.518E-15	168	0.429	0.470	O88273.pdb.gz	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
6	PDB:5hk5F	0.524	0.727	3.447E-13	129	0.429	0.612	5hk5F.pdb.gz
7	AFDB:Q9PUK2	0.471	0.329	1.139E-7	272	0.212	0.143	Q9PUK2.pdb.gz	Q9PUK2_CHICK Caronte OS=Gallus gallus OX=9031 GN=CAR PE=2 SV=1
8	AFDB:O73753	0.481	0.505	1.903E-7	175	0.179	0.189	O73753.pdb.gz	NBL1_XENLA Neuroblastoma suppressor of tumorigenicity 1 OS=Xenopus laevis OX=8355 GN=nbl1 PE=1 SV=1
9	AFDB:Q90YC9	0.479	0.497	5.960E-7	177	0.168	0.175	Q90YC9.pdb.gz	NBL1_CHICK Neuroblastoma suppressor of tumorigenicity 1 OS=Gallus gallus OX=9031 GN=NBL1 PE=2 SV=2
10	AFDB:Q76LW6	0.449	0.447	8.394E-7	185	0.239	0.238	Q76LW6.pdb.gz	DAND5_MOUSE DAN domain family member 5 OS=Mus musculus OX=10090 GN=Dand5 PE=2 SV=1
11	AFDB:Q6NZ13	0.480	0.483	1.325E-6	183	0.179	0.180	Q6NZ13.pdb.gz	NBL1_DANRE Neuroblastoma suppressor of tumorigenicity 1 OS=Danio rerio OX=7955 GN=nbl1 PE=2 SV=1
12	PDB:4my2A	0.376	0.158	3.236E-4	474	0.092	0.036	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
13	PDB:2k8pA	0.354	0.346	6.418E-4	189	0.163	0.159	2k8pA.pdb.gz
14	PDB:4mqwB	0.342	0.546	1.481E-2	109	0.092	0.156	4mqwB.pdb.gz
15	PDB:7t9iB	0.344	0.543	4.639E-2	109	0.098	0.165	7t9iB.pdb.gz
16	PDB:1hcnB	0.330	0.508	6.916E-2	110	0.087	0.145	1hcnB.pdb.gz
17	PDB:5nxsA	0.285	0.192	1.628E-1	290	0.087	0.055	5nxsA.pdb.gz
18	PDB:5ntuA	0.269	0.171	3.620E-1	308	0.087	0.052	5ntuA.pdb.gz
19	PDB:3ij2A	0.236	0.359	5.397E-1	110	0.065	0.109	3ij2A.pdb.gz
20	PDB:5hlyA	0.253	0.165	1.071	299	0.114	0.070	5hlyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60565	9.86e-138	383	184	1.000	1.000	GREM1_HUMAN Gremlin-1 OS=Homo sapiens OX=9606 GN=GREM1 PE=1 SV=1
2	O35793	4.76e-135	376	184	0.984	0.984	GREM1_RAT Gremlin-1 OS=Rattus norvegicus OX=10116 GN=Grem1 PE=1 SV=1
3	O70326	2.58e-134	375	184	0.978	0.978	GREM1_MOUSE Gremlin-1 OS=Mus musculus OX=10090 GN=Grem1 PE=2 SV=1
4	R0KDQ4	2.13e-112	319	184	0.832	0.832	R0KDQ4_ANAPL Gremlin 1, DAN family BMP antagonist (Fragment) OS=Anas platyrhynchos OX=8839 GN=GREM1 PE=3 SV=1
5	O73754	7.91e-100	287	182	0.772	0.780	GREM1_XENLA Gremlin-1 OS=Xenopus laevis OX=8355 GN=grem1 PE=2 SV=1
6	Q9H772	6.41e-64	196	168	0.522	0.571	GREM2_HUMAN Gremlin-2 OS=Homo sapiens OX=9606 GN=GREM2 PE=1 SV=1
7	Q566Z5	6.87e-60	186	166	0.462	0.512	Q566Z5_DANRE Gremlin OS=Danio rerio OX=7955 GN=grem2 PE=2 SV=1
8	O88273	7.19e-59	183	168	0.495	0.542	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
9	O95813	9.79e-14	69.3	267	0.196	0.135	CER1_HUMAN Cerberus OS=Homo sapiens OX=9606 GN=CER1 PE=1 SV=1
10	Q90YC9	1.07e-11	62.4	177	0.163	0.169	NBL1_CHICK Neuroblastoma suppressor of tumorigenicity 1 OS=Gallus gallus OX=9031 GN=NBL1 PE=2 SV=2
11	Q61477	1.37e-11	62.0	178	0.158	0.163	NBL1_MOUSE Neuroblastoma suppressor of tumorigenicity 1 OS=Mus musculus OX=10090 GN=Nbl1 PE=1 SV=2
12	P41271	1.39e-11	62.4	181	0.158	0.160	NBL1_HUMAN Neuroblastoma suppressor of tumorigenicity 1 OS=Homo sapiens OX=9606 GN=NBL1 PE=1 SV=2
13	O73753	1.58e-11	62.0	175	0.168	0.177	NBL1_XENLA Neuroblastoma suppressor of tumorigenicity 1 OS=Xenopus laevis OX=8355 GN=nbl1 PE=1 SV=1
14	Q6NZ13	4.20e-11	60.8	183	0.196	0.197	NBL1_DANRE Neuroblastoma suppressor of tumorigenicity 1 OS=Danio rerio OX=7955 GN=nbl1 PE=2 SV=1
15	O55233	8.56e-11	61.2	272	0.179	0.121	CER1_MOUSE Cerberus OS=Mus musculus OX=10090 GN=Cer1 PE=1 SV=1
16	Q9PWB0	2.56e-10	60.1	272	0.168	0.114	CER1_CHICK Cerberus OS=Gallus gallus OX=9031 GN=CER1 PE=2 SV=1
17	Q9PUK2	3.98e-10	59.3	272	0.168	0.114	Q9PUK2_CHICK Caronte OS=Gallus gallus OX=9031 GN=CAR PE=2 SV=1
18	P70041	1.51e-09	57.8	270	0.152	0.104	CER1_XENLA Cerberus OS=Xenopus laevis OX=8355 GN=cer1 PE=1 SV=1
19	Q800X4	1.49e-08	54.3	217	0.217	0.184	DAND5_XENLA DAN domain family member 5 OS=Xenopus laevis OX=8355 GN=dand5 PE=1 SV=1
20	Q76C29	2.10e-08	54.3	243	0.174	0.132	Q76C29_DANRE DAN domain family, member 5 precursor OS=Danio rerio OX=7955 GN=charon PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02166 Androgen_recep	8.6e+02	10.0	Androgen receptor
2	PF03045 DAN	5.2e-40	147.4	DAN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 72004.XP_005892537.1

Rank	PPI partner	STRING score	Description
1	72004.XP_005891112.1	0.953	Bone morphogenetic protein 2
2	72004.XP_005901990.1	0.951	Bone morphogenetic protein 4 isoform X1
3	72004.XP_005888035.1	0.889	Bone morphogenetic protein 7
4	72004.XP_005902710.1	0.815	Bone morphogenetic protein 5 isoform X1
5	72004.XP_005900502.1	0.802	Growth differentiation factor 5
6	72004.XP_005911840.1	0.801	Bone morphogenetic protein 6
7	72004.XP_005910047.1	0.794	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
8	72004.XP_005889459.1	0.770	BMP and activin membrane-bound inhibitor homolog
9	72004.XP_005907921.1	0.763	Bone morphogenetic protein receptor type-1B isoform X1
10	72004.XP_005904318.1	0.749	Bone morphogenetic protein receptor type-2
11	72004.XP_005899123.1	0.739	Kinase insert domain receptor
12	72004.XP_005900943.1	0.735	Growth differentiation factor 6
13	72004.XP_005888453.1	0.728	anti-Mullerian hormone
14	72004.XP_005895820.1	0.727	Growth/differentiation factor 9-like
15	72004.XP_005904943.1	0.724	Bone morphogenetic protein 8b
16	72004.XP_005907845.1	0.724	Bone morphogenetic protein 8a
17	72004.XP_005909564.1	0.645	Chordin
18	72004.XP_005906458.1	0.638	Twist family bHLH transcription factor 2
19	72004.XP_005898588.1	0.629	Hemochromatosis type 2 (juvenile)
20	72004.XP_005891638.1	0.628	Repulsive guidance molecule family member a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	0.999	cytokine binding
GO:0036122	0.977	BMP binding
GO:0098772	0.935	molecular function regulator activity
GO:0005102	0.931	signaling receptor binding
GO:0042802	0.911	identical protein binding
GO:0140677	0.848	molecular function activator activity
GO:0030545	0.489	signaling receptor regulator activity
GO:0030546	0.422	signaling receptor activator activity
GO:0048018	0.409	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0050793	0.993	regulation of developmental process
GO:0090287	0.992	regulation of cellular response to growth factor stimulus
GO:0048518	0.988	positive regulation of biological process
GO:0009987	0.987	cellular process
GO:0007275	0.986	multicellular organism development
GO:0051239	0.983	regulation of multicellular organismal process
GO:0019222	0.982	regulation of metabolic process
GO:0030510	0.981	regulation of BMP signaling pathway
GO:0090101	0.981	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090288	0.980	negative regulation of cellular response to growth factor stimulus
GO:0080090	0.970	regulation of primary metabolic process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:2000026	0.968	regulation of multicellular organismal development
GO:0030514	0.967	negative regulation of BMP signaling pathway
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0048522	0.965	positive regulation of cellular process
GO:0050896	0.958	response to stimulus
GO:0045667	0.949	regulation of osteoblast differentiation
GO:0051093	0.936	negative regulation of developmental process
GO:0022603	0.931	regulation of anatomical structure morphogenesis
GO:0045596	0.877	negative regulation of cell differentiation
GO:0010468	0.868	regulation of gene expression
GO:0044093	0.863	positive regulation of molecular function
GO:0010941	0.848	regulation of cell death
GO:0051247	0.847	positive regulation of protein metabolic process
GO:0009653	0.846	anatomical structure morphogenesis
GO:0001932	0.818	regulation of protein phosphorylation
GO:0051241	0.797	negative regulation of multicellular organismal process
GO:0009889	0.790	regulation of biosynthetic process
GO:0048731	0.790	system development
GO:0051716	0.787	cellular response to stimulus
GO:0042981	0.782	regulation of apoptotic process
GO:0010556	0.774	regulation of macromolecule biosynthetic process
GO:0019219	0.774	regulation of nucleobase-containing compound metabolic process
GO:0051128	0.772	regulation of cellular component organization
GO:0031326	0.767	regulation of cellular biosynthetic process
GO:0030334	0.763	regulation of cell migration
GO:0031325	0.763	positive regulation of cellular metabolic process
GO:0016043	0.760	cellular component organization
GO:0001822	0.758	kidney development
GO:0007154	0.752	cell communication
GO:0042127	0.752	regulation of cell population proliferation
GO:0051094	0.744	positive regulation of developmental process
GO:0072073	0.732	kidney epithelium development
GO:0045668	0.725	negative regulation of osteoblast differentiation
GO:0023052	0.722	signaling
GO:0060548	0.715	negative regulation of cell death
GO:0009892	0.705	negative regulation of metabolic process
GO:0050790	0.701	regulation of catalytic activity
GO:0030336	0.700	negative regulation of cell migration
GO:0051240	0.698	positive regulation of multicellular organismal process
GO:0035295	0.696	tube development
GO:0043085	0.675	positive regulation of catalytic activity
GO:0010557	0.671	positive regulation of macromolecule biosynthetic process
GO:0031328	0.668	positive regulation of cellular biosynthetic process
GO:0045935	0.668	positive regulation of nucleobase-containing compound metabolic process
GO:0045765	0.661	regulation of angiogenesis
GO:0043069	0.622	negative regulation of programmed cell death
GO:0051338	0.613	regulation of transferase activity
GO:0043066	0.609	negative regulation of apoptotic process
GO:0045766	0.608	positive regulation of angiogenesis
GO:0009855	0.587	determination of bilateral symmetry
GO:0007165	0.575	signal transduction
GO:0010605	0.558	negative regulation of macromolecule metabolic process
GO:0048263	0.557	determination of dorsal identity
GO:2001141	0.540	regulation of RNA biosynthetic process
GO:0032101	0.530	regulation of response to external stimulus
GO:0006355	0.495	regulation of DNA-templated transcription
GO:0071363	0.492	cellular response to growth factor stimulus
GO:0048869	0.488	cellular developmental process
GO:0030154	0.482	cell differentiation
GO:0023056	0.461	positive regulation of signaling
GO:0048584	0.460	positive regulation of response to stimulus
GO:0010647	0.460	positive regulation of cell communication
GO:0009967	0.452	positive regulation of signal transduction
GO:0007166	0.420	cell surface receptor signaling pathway
GO:0051254	0.378	positive regulation of RNA metabolic process
GO:0045893	0.370	positive regulation of DNA-templated transcription
GO:0007167	0.369	enzyme-linked receptor protein signaling pathway
GO:0006357	0.324	regulation of transcription by RNA polymerase II
GO:0009887	0.323	animal organ morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.989	extracellular space
GO:0071944	0.954	cell periphery
GO:0005622	0.746	intracellular anatomical structure
GO:0043226	0.717	organelle
GO:0043231	0.710	intracellular membrane-bounded organelle
GO:0009986	0.692	cell surface
GO:0005737	0.678	cytoplasm
GO:0005886	0.497	plasma membrane
GO:0012505	0.385	endomembrane system
GO:0043233	0.376	organelle lumen
GO:0070013	0.360	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]