StarFunc result for job id O60566

User Input

>input (1050 residues)
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKR
AFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPR
FLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQ
QKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARA
PIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPM
PRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEP
SINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVF
RKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKL
QIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKK
NKSPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVT
ICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIY
SQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQS
PWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKL
FWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYIN
CFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDC
NKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLA
HLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMN
GVFDTTFQSHLNKALWKVGKLTSPGALLFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60566	1.000	1.000	0.000	1050	1.000	1.000	O60566.pdb.gz	BUB1B_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B PE=1 SV=3
2	AFDB:Q9Z1S0	0.332	0.331	6.443E-102	1052	0.755	0.754	Q9Z1S0.pdb.gz	BUB1B_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Mus musculus OX=10090 GN=Bub1b PE=1 SV=2
3	PDB:6tljS	0.235	0.756	6.207E-28	293	0.271	0.973	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
4	AFDB:Q9VMS5	0.257	0.246	1.483E-25	1099	0.195	0.187	Q9VMS5.pdb.gz	Q9VMS5_DROME Bub1 kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Bub1 PE=2 SV=1
5	AFDB:A1Z6I7	0.263	0.194	1.228E-22	1460	0.227	0.163	A1Z6I7.pdb.gz	A1Z6I7_DROME Bub1-related kinase OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=1 SV=1
6	AFDB:A0A0R4IPD5	0.153	0.196	4.690E-7	800	0.095	0.125	A0A0R4IPD5.pdb.gz
7	AFDB:O81472	0.152	0.199	6.458E-7	773	0.096	0.131	O81472.pdb.gz	MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana OX=3702 GN=MEKK2 PE=1 SV=1
8	PDB:6qx9K	0.168	0.483	2.451E-6	322	0.048	0.155	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
9	PDB:6fadC	0.165	0.418	7.342E-6	359	0.039	0.114	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
10	PDB:7cgaA	0.154	0.410	7.342E-6	347	0.049	0.147	7cgaA.pdb.gz
11	PDB:4yc3A	0.173	0.520	1.271E-5	295	0.041	0.146	4yc3A.pdb.gz
12	PDB:6g4jA	0.192	0.620	1.671E-5	273	0.038	0.147	6g4jA.pdb.gz
13	PDB:2x4fA	0.182	0.561	1.917E-5	289	0.035	0.128	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156
14	PDB:8bfsA	0.175	0.558	2.101E-5	274	0.043	0.164	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
15	PDB:5xvuA	0.115	0.298	2.640E-5	321	0.044	0.143	5xvuA.pdb.gz	The protein kinase CK2 catalytic domain from Plasmodium falciparum: crystal structure, tyrosine kinase activity and inhibition.
16	PDB:4eomC	0.162	0.532	2.893E-5	276	0.038	0.145	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	AFDB:Q10407	0.158	0.150	6.836E-5	1116	0.132	0.125	Q10407.pdb.gz	MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mkh1 PE=3 SV=1
18	AFDB:P07527	0.173	0.203	1.629E-4	877	0.102	0.122	P07527.pdb.gz	WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wee1 PE=1 SV=1
19	AFDB:O95835	0.157	0.148	1.956E-4	1130	0.102	0.095	O95835.pdb.gz	LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1
20	AFDB:Q09690	0.167	0.162	1.956E-4	1087	0.110	0.106	Q09690.pdb.gz	POM1_SCHPO DYRK-family kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pom1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60566	0.0	2179	1050	1.000	1.000	BUB1B_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B PE=1 SV=3
2	Q9Z1S0	0.0	1573	1052	0.756	0.755	BUB1B_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Mus musculus OX=10090 GN=Bub1b PE=1 SV=2
3	Q7KN56	1.50e-39	162	1484	0.086	0.061	Q7KN56_DROME LD23835p (Fragment) OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=2 SV=1
4	A1Z6I7	1.92e-39	162	1460	0.081	0.058	A1Z6I7_DROME Bub1-related kinase OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=1 SV=1
5	O76755	1.99e-39	162	1461	0.081	0.058	O76755_DROME Mitotic checkpoint control protein kinase BUB1 OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=2 SV=1
6	O22806	2.45e-30	126	395	0.084	0.223	BUBR1_ARATH Mitotic spindle checkpoint protein BUBR1 OS=Arabidopsis thaliana OX=3702 GN=BUBR1 PE=1 SV=2
7	O08901	4.74e-28	124	1058	0.060	0.060	BUB1_MOUSE Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Mus musculus OX=10090 GN=Bub1 PE=1 SV=1
8	D4A5D3	9.75e-27	120	1059	0.115	0.114	D4A5D3_RAT BUB1 mitotic checkpoint serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bub1 PE=4 SV=1
9	O43683	1.27e-26	120	1085	0.055	0.053	BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens OX=9606 GN=BUB1 PE=1 SV=1
10	A0A8I6GIT9	1.48e-26	119	965	0.115	0.125	A0A8I6GIT9_RAT BUB1 mitotic checkpoint serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bub1 PE=4 SV=1
11	O59767	5.21e-25	108	310	0.060	0.203	MAD3_SCHPO Mitotic spindle checkpoint component mad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mad3 PE=1 SV=2
12	Q9VMS5	2.20e-22	106	1099	0.051	0.049	Q9VMS5_DROME Bub1 kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Bub1 PE=2 SV=1
13	P47074	8.19e-20	96.7	515	0.060	0.122	MAD3_YEAST Spindle assembly checkpoint component MAD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD3 PE=1 SV=1
14	Q9FFG4	1.52e-16	86.3	471	0.038	0.085	Q9FFG4_ARATH At5g05510 OS=Arabidopsis thaliana OX=3702 GN=MOP10.5 PE=1 SV=1
15	P41695	1.13e-10	68.6	1021	0.043	0.044	BUB1_YEAST Checkpoint serine/threonine-protein kinase BUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUB1 PE=1 SV=2
16	Q21776	5.39e-08	59.7	987	0.053	0.057	BUB1_CAEEL Mitotic checkpoint serine/threonine-protein kinase bub-1 OS=Caenorhabditis elegans OX=6239 GN=bub-1 PE=1 SV=1
17	O94751	9.74e-05	48.9	1044	0.050	0.051	BUB1_SCHPO Checkpoint serine/threonine-protein kinase bub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bub1 PE=1 SV=1
18	A0A8I6GA79	4.85e-04	46.6	1014	0.030	0.032	A0A8I6GA79_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Ulk1 PE=4 SV=1
19	D3ZMG0	7.10e-04	46.2	1057	0.028	0.027	D3ZMG0_RAT Serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Ulk1 PE=1 SV=3
20	O70405	0.001	45.4	1051	0.028	0.028	ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus OX=10090 GN=Ulk1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08311 Mad3_BUB1_I	2.3e-39	145.5	Mad3/BUB1 homology region 1
2	PF08171 Mad3_BUB1_II	38	15.9	Mad3/BUB1 homology region 2
3	PF00069 Pkinase	0.0015	29.6	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	25	15.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287598

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265148	0.999	Centromere-associated protein E
2	9606.ENSP00000296509	0.999	Mitotic spindle assembly checkpoint protein MAD2A
3	9606.ENSP00000300093	0.999	Serine/threonine-protein kinase PLK1
4	9606.ENSP00000335463	0.999	Kinetochore scaffold 1
5	9606.ENSP00000357858	0.999	Mitotic checkpoint protein BUB3
6	9606.ENSP00000361540	0.999	Cell division cycle protein 20 homolog
7	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
8	9606.ENSP00000426654	0.999	Anaphase-promoting complex subunit 4
9	9606.ENSP00000434614	0.999	Cell division cycle protein 27 homolog
10	9606.ENSP00000256442	0.998	G2/mitotic-specific cyclin-B1
11	9606.ENSP00000302530	0.998	Mitotic checkpoint serine/threonine-protein kinase BUB1
12	9606.ENSP00000339109	0.998	Anaphase-promoting complex subunit 1
13	9606.ENSP00000353549	0.998	Cell division cycle protein 16 homolog
14	9606.ENSP00000378350	0.998	Cell division cycle protein 23 homolog
15	9606.ENSP00000261597	0.997	Kinetochore protein NDC80 homolog
16	9606.ENSP00000355922	0.997	Centromere protein F
17	9606.ENSP00000478501	0.996	Anaphase-promoting complex subunit 10
18	9606.ENSP00000261819	0.995	Anaphase-promoting complex subunit 5
19	9606.ENSP00000313950	0.995	Aurora kinase B
20	9606.ENSP00000358813	0.995	Dual specificity protein kinase TTK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0050794	0.979	regulation of cellular process
GO:1903047	0.961	mitotic cell cycle process
GO:0033045	0.960	regulation of sister chromatid segregation
GO:0007093	0.929	mitotic cell cycle checkpoint signaling
GO:0045841	0.926	negative regulation of mitotic metaphase/anaphase transition
GO:0019222	0.925	regulation of metabolic process
GO:0051171	0.921	regulation of nitrogen compound metabolic process
GO:0031577	0.921	spindle checkpoint signaling
GO:0080090	0.920	regulation of primary metabolic process
GO:0060255	0.919	regulation of macromolecule metabolic process
GO:0071173	0.830	spindle assembly checkpoint signaling
GO:0071174	0.830	mitotic spindle checkpoint signaling
GO:0007094	0.821	mitotic spindle assembly checkpoint signaling
GO:0031399	0.811	regulation of protein modification process
GO:0051338	0.728	regulation of transferase activity
GO:0009892	0.484	negative regulation of metabolic process
GO:1903320	0.467	regulation of protein modification by small protein conjugation or removal
GO:0010605	0.464	negative regulation of macromolecule metabolic process
GO:0008152	0.463	metabolic process
GO:0071704	0.451	organic substance metabolic process
GO:0044238	0.436	primary metabolic process
GO:0006807	0.428	nitrogen compound metabolic process
GO:0051172	0.419	negative regulation of nitrogen compound metabolic process
GO:0043170	0.412	macromolecule metabolic process
GO:0031323	0.316	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0000940	0.996	outer kinetochore
GO:0005634	0.995	nucleus
GO:0005829	0.994	cytosol
GO:0005654	0.971	nucleoplasm
GO:0015630	0.922	microtubule cytoskeleton
GO:0140513	0.919	nuclear protein-containing complex
GO:0005819	0.912	spindle
GO:1902494	0.911	catalytic complex
GO:1990234	0.656	transferase complex
GO:0140535	0.647	intracellular protein-containing complex
GO:0000151	0.616	ubiquitin ligase complex
GO:0000152	0.598	nuclear ubiquitin ligase complex
GO:0031461	0.470	cullin-RING ubiquitin ligase complex
GO:0048471	0.403	perinuclear region of cytoplasm
GO:0005680	0.384	anaphase-promoting complex
GO:0033597	0.376	mitotic checkpoint complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]