StarFunc result for job id O60568

User Input

>input (738 residues)
MTSSGPGPRFLLLLPLLLPPAASASDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAE
FFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAG
SPTELLKKFVQSGSRLLFSAESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIV
RQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRVRI
RNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFL
AVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLV
GPEEALSPGEARDMAMDLCRQDPECEFYFSLDADAVLTNLQTLRILIEENRKVIAPMLSR
HGKLWSNFWGALSPDEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGDTLRMELPQRD
VFSGSDTDPDMAFCKSFRDKGIFLHLSNQHEFGRLLATSRYDTEHLHPDLWQIFDNPVDW
KEQYIHENYSRALEGEGIVEQPCPDVYWFPLLSEQMCDELVAEMEHYGQWSGGRHEDSRL
AGGYENVPTVDIHMKQVGYEDQWLQLLRTYVGPMTESLFPGYHTKARAVMNFVVRYRPDE
QPSLRPHHDSSTFTLNVALNHKGLDYEGGGCRFLRYDCVISSPRKGWALLHPGRLTHYHE
GLPTTWGTRYIMVSFVDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6fxrA	0.931	0.981	0.000	700	0.949	1.000	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
2	AFDB:A0A2R8QKS4	0.951	0.961	0.000	730	0.636	0.642	A0A2R8QKS4.pdb.gz
3	AFDB:A0JMD1	0.930	0.940	0.000	730	0.560	0.566	A0JMD1.pdb.gz
4	AFDB:A4U7F8	0.947	0.954	0.000	733	0.577	0.581	A4U7F8.pdb.gz	A4U7F8_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
5	AFDB:A4U7F9	0.958	0.938	0.000	754	0.581	0.569	A4U7F9.pdb.gz	A4U7F9_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
6	AFDB:O00469	0.959	0.960	0.000	737	0.579	0.579	O00469.pdb.gz	PLOD2_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2
7	AFDB:Q5U367	0.961	0.957	0.000	741	0.913	0.910	Q5U367.pdb.gz	PLOD3_RAT Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Rattus norvegicus OX=10116 GN=Plod3 PE=1 SV=1
8	AFDB:Q63321	0.936	0.949	0.000	728	0.573	0.581	Q63321.pdb.gz	PLOD1_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Rattus norvegicus OX=10116 GN=Plod1 PE=1 SV=1
9	AFDB:Q9VTH0	0.919	0.941	0.000	721	0.443	0.454	Q9VTH0.pdb.gz	PLOD_DROME Procollagen-lysine,2-oxoglutarate 5-dioxygenase OS=Drosophila melanogaster OX=7227 GN=Plod PE=1 SV=1
10	AFDB:Q20679	0.927	0.937	3.036E-101	730	0.457	0.462	Q20679.pdb.gz	PLOD_CAEEL Multifunctional procollagen lysine hydroxylase and glycosyltransferase OS=Caenorhabditis elegans OX=6239 GN=let-268 PE=1 SV=1
11	AFDB:Q8IYK4	0.283	0.332	2.367E-20	626	0.098	0.115	Q8IYK4.pdb.gz	GT252_HUMAN Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
12	PDB:2d7iA	0.208	0.269	2.233E-6	536	0.061	0.084	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
13	PDB:4d0tA	0.243	0.344	2.516E-6	496	0.047	0.071	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
14	PDB:6pxuB	0.252	0.334	6.152E-6	532	0.081	0.113	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
15	PDB:4d11C	0.238	0.374	8.287E-6	436	0.053	0.089	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
16	PDB:6h0bB	0.243	0.330	8.287E-6	521	0.041	0.058	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
17	PDB:4fixA	0.218	0.250	8.796E-6	629	0.051	0.060	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
18	PDB:6iwqA	0.232	0.301	8.796E-6	546	0.054	0.073	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
19	PDB:2xwnB	0.197	0.534	9.910E-6	227	0.043	0.141	2xwnB.pdb.gz	Structural and Functional Studies on Mycobacterial Ispd Enzymes
20	PDB:3kt4A	0.205	0.260	2.283E-5	563	0.033	0.043	3kt4A.pdb.gz	Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KNH4	0.0	1032	730	0.640	0.647	A3KNH4_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=cb479 PE=1 SV=1
2	A4U7F8	0.0	965	733	0.577	0.581	A4U7F8_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
3	A4U7F9	0.0	955	754	0.579	0.566	A4U7F9_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
4	A8WIN7	0.0	909	730	0.561	0.567	A8WIN7_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=fc95g08 PE=1 SV=1
5	O00469	0.0	947	737	0.573	0.574	PLOD2_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2
6	O60568	0.0	1529	738	1.000	1.000	PLOD3_HUMAN Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1
7	Q02809	0.0	918	727	0.569	0.578	PLOD1_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2
8	Q20679	0.0	678	730	0.461	0.466	PLOD_CAEEL Multifunctional procollagen lysine hydroxylase and glycosyltransferase OS=Caenorhabditis elegans OX=6239 GN=let-268 PE=1 SV=1
9	Q5U367	0.0	1393	741	0.894	0.891	PLOD3_RAT Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Rattus norvegicus OX=10116 GN=Plod3 PE=1 SV=1
10	Q63321	0.0	914	728	0.573	0.581	PLOD1_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Rattus norvegicus OX=10116 GN=Plod1 PE=1 SV=1
11	Q811A3	0.0	949	737	0.580	0.581	PLOD2_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Rattus norvegicus OX=10116 GN=Plod2 PE=2 SV=1
12	Q9R0E1	0.0	1396	741	0.916	0.912	PLOD3_MOUSE Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Mus musculus OX=10090 GN=Plod3 PE=1 SV=1
13	Q9R0E2	0.0	893	728	0.572	0.580	PLOD1_MOUSE Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Mus musculus OX=10090 GN=Plod1 PE=1 SV=1
14	Q9VTH0	0.0	667	721	0.440	0.451	PLOD_DROME Procollagen-lysine,2-oxoglutarate 5-dioxygenase OS=Drosophila melanogaster OX=7227 GN=Plod PE=1 SV=1
15	Q8IYK4	1.73e-19	95.5	626	0.115	0.136	GT252_HUMAN Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
16	Q5T4B2	7.83e-14	77.4	595	0.088	0.109	GT253_HUMAN Inactive glycosyltransferase 25 family member 3 OS=Homo sapiens OX=9606 GN=CERCAM PE=1 SV=1
17	Q8NBJ5	1.44e-10	67.0	622	0.084	0.100	GT251_HUMAN Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
18	Q3ED68	1.00e-07	57.4	397	0.069	0.128	ICU11_ARATH 2-oxoglutarate and iron-dependent oxygenase domain-containing protein ICU11 OS=Arabidopsis thaliana OX=3702 GN=ICU11 PE=2 SV=2
19	P0DO23	1.53e-06	53.5	394	0.083	0.155	CP2_ARATH 2-oxoglutarate and iron-dependent oxygenase domain-containing protein CP2 OS=Arabidopsis thaliana OX=3702 GN=CP2 PE=1 SV=1
20	Q6N063	2.44e-04	46.2	350	0.065	0.137	OGFD2_HUMAN 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=OGFOD2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03171 2OG-FeII_Oxy	0.025	26.4	2OG-Fe(II) oxygenase superfamily
2	PF13640 2OG-FeII_Oxy_3	1.2	21.4	2OG-Fe(II) oxygenase superfamily
3	PF03452 Anp1	3.6e+02	11.9	Anp1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000223127

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252599	0.953	Procollagen galactosyltransferase 1
2	9606.ENSP00000354960	0.924	Procollagen galactosyltransferase 2
3	9606.ENSP00000196061	0.917	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
4	9606.ENSP00000282903	0.905	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
5	9606.ENSP00000367755	0.900	Calmodulin-lysine N-methyltransferase
6	9606.ENSP00000364678	0.818	Histone-lysine N-methyltransferase EHMT2
7	9606.ENSP00000225964	0.791	Collagen alpha-1(I) chain
8	9606.ENSP00000364000	0.782	Collagen alpha-2(V) chain
9	9606.ENSP00000364979	0.772	Collagen alpha-1(IV) chain
10	9606.ENSP00000304408	0.767	Collagen alpha-1(III) chain
11	9606.ENSP00000331902	0.758	Collagen alpha-5(IV) chain
12	9606.ENSP00000297268	0.741	Collagen alpha-2(I) chain
13	9606.ENSP00000353654	0.726	Collagen alpha-2(IV) chain
14	9606.ENSP00000332371	0.722	Collagen alpha-1(VII) chain
15	9606.ENSP00000360882	0.720	Collagen alpha-1(V) chain
16	9606.ENSP00000378340	0.720	Collagen alpha-6(IV) chain
17	9606.ENSP00000263556	0.711	Prolyl 4-hydroxylase subunit alpha-1
18	9606.ENSP00000340937	0.711	Collagen alpha-1(XVII) chain
19	9606.ENSP00000348385	0.711	Collagen alpha-1(XXVII) chain
20	9606.ENSP00000359114	0.704	Collagen alpha-1(XI) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008475	0.999	procollagen-lysine 5-dioxygenase activity
GO:0046527	0.996	glucosyltransferase activity
GO:0005488	0.995	binding
GO:0005515	0.986	protein binding
GO:0008194	0.703	UDP-glycosyltransferase activity
GO:0035250	0.636	UDP-galactosyltransferase activity
GO:0043167	0.572	ion binding
GO:0036094	0.519	small molecule binding
GO:0043169	0.499	cation binding
GO:0046872	0.473	metal ion binding
GO:0033823	0.354	procollagen glucosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0036211	0.988	protein modification process
GO:0018126	0.974	protein hydroxylation
GO:0016043	0.955	cellular component organization
GO:0045229	0.859	external encapsulating structure organization
GO:0043062	0.858	extracellular structure organization
GO:0018205	0.851	peptidyl-lysine modification
GO:0030198	0.643	extracellular matrix organization
GO:0097435	0.615	supramolecular fiber organization
GO:0044237	0.558	cellular metabolic process
GO:0048856	0.553	anatomical structure development
GO:0030199	0.546	collagen fibril organization
GO:0065007	0.486	biological regulation
GO:0050896	0.475	response to stimulus
GO:0032501	0.400	multicellular organismal process
GO:0050789	0.377	regulation of biological process
GO:0007275	0.341	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0005615	0.999	extracellular space
GO:0071944	0.997	cell periphery
GO:0016020	0.994	membrane
GO:0031012	0.977	extracellular matrix
GO:0031984	0.977	organelle subcompartment
GO:0062023	0.968	collagen-containing extracellular matrix
GO:0005794	0.953	Golgi apparatus
GO:0070013	0.885	intracellular organelle lumen
GO:0031090	0.867	organelle membrane
GO:0031982	0.783	vesicle
GO:0042175	0.756	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.743	endoplasmic reticulum membrane
GO:0043230	0.717	extracellular organelle
GO:0070062	0.705	extracellular exosome
GO:0032991	0.615	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16569	0.999	2-oxoglutarate + L-lysyl-[collagen] + O2 = (5R)-5-hydroxy-L-lysyl-[collagen] + CO2 + succinate
EC:1.14.11.4	0.999	procollagen-lysine 5-dioxygenase.
EC:2.4.1.-	0.996	Hexosyltransferases.
RHEA:12576	0.354	(5R)-5-O-(beta-D-galactosyl)-5-hydroxy-L-lysyl-[collagen] + UDP-alpha-D-glucose = (5R)-5-O-[alpha-D-glucosyl-(1->2)-beta-D-galactosyl]-5-hydroxy-L-lysyl-[collagen] + H(+) + UDP
EC:2.4.1.66	0.354	procollagen glucosyltransferase.

[back to server]