StarFunc result for job id O60583

User Input

>input (730 residues)
MASGRGASSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINT
AIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDT
KCDAYLQQTQELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNS
LHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEF
LQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPS
FQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSART
EQLYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSVKQEYTHKAGSSKHH
GPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTS
PIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDE
GSGKSKHSSPHISRDHKEKHKEHPSSRHHTSSHKHSHSHSGSSSGGSKHSADGIPPTVLR
SPVGLSSDGISSSSSSSRKRLHVNDASHNHHSKMSKSSKSSGSSSSSSSSVKQYISSHNS
VFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVETNGPDANHEYSTSSQHMDYKDTFDMLD
SLLSAQGMNM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60583	1.000	1.000	1.342E-76	730	1.000	1.000	O60583.pdb.gz	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
2	AFDB:O60563	0.354	0.356	1.073E-34	726	0.459	0.461	O60563.pdb.gz	CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1
3	AFDB:D3ZC98	0.281	0.308	1.982E-26	663	0.368	0.406	D3ZC98.pdb.gz	D3ZC98_RAT Cyclin T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=3 SV=1
4	PDB:6gzhB	0.337	0.968	3.135E-26	252	0.278	0.806	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
5	AFDB:O96433	0.334	0.224	9.736E-25	1097	0.330	0.220	O96433.pdb.gz	CCNT_DROME Cyclin-T OS=Drosophila melanogaster OX=7227 GN=CycT PE=1 SV=2
6	PDB:7kpvB	0.273	0.642	8.504E-8	290	0.073	0.183	7kpvB.pdb.gz
7	PDB:5hbhB	0.279	0.713	1.869E-7	270	0.084	0.226	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
8	PDB:1zp2A	0.240	0.714	5.832E-7	227	0.052	0.167	1zp2A.pdb.gz
9	PDB:7jv7B	0.282	0.629	1.462E-6	310	0.047	0.110	7jv7B.pdb.gz
10	PDB:7kueB	0.239	0.691	8.555E-5	225	0.060	0.196	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
11	PDB:7b5lY	0.245	0.648	1.511E-4	253	0.060	0.174	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
12	PDB:7egb9	0.227	0.514	1.511E-4	287	0.070	0.178	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:7nj0C	0.257	0.651	1.649E-4	270	0.047	0.126	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
14	PDB:2w96A	0.251	0.654	5.375E-4	249	0.045	0.133	2w96A.pdb.gz
15	AFDB:F1R8J2	0.095	0.050	5.684E-2	2014	0.141	0.051	F1R8J2.pdb.gz
16	AFDB:Q6PCP7	0.074	0.069	5.684E-2	798	0.141	0.129	Q6PCP7.pdb.gz	GP156_MOUSE Probable G-protein coupled receptor 156 OS=Mus musculus OX=10090 GN=Gpr156 PE=2 SV=2
17	AFDB:Q8NFN8	0.069	0.064	2.112E-1	814	0.144	0.129	Q8NFN8.pdb.gz	GP156_HUMAN Probable G-protein coupled receptor 156 OS=Homo sapiens OX=9606 GN=GPR156 PE=2 SV=2
18	AFDB:F1SPM8	0.059	0.052	2.629E-1	968	0.129	0.097	F1SPM8.pdb.gz	AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2
19	AFDB:Q8I2B4	0.069	0.042	2.746E-1	1567	0.129	0.060	Q8I2B4.pdb.gz	Q8I2B4_PLAF7 Erythrocyte binding antigen-181 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0102500 PE=4 SV=1
20	AFDB:Q9Y4G8	0.092	0.055	3.571E-1	1499	0.130	0.063	Q9Y4G8.pdb.gz	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60583	0.0	1505	730	1.000	1.000	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
2	Q7TQK0	0.0	1252	723	0.870	0.878	CCNT2_MOUSE Cyclin-T2 OS=Mus musculus OX=10090 GN=Ccnt2 PE=1 SV=1
3	O60563	4.59e-172	513	726	0.467	0.470	CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1
4	Q9QWV9	5.74e-155	469	724	0.293	0.296	CCNT1_MOUSE Cyclin-T1 OS=Mus musculus OX=10090 GN=Ccnt1 PE=1 SV=3
5	A0A0G2JXM2	1.31e-154	468	724	0.293	0.296	A0A0G2JXM2_RAT Cyclin-T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=1 SV=2
6	O96433	4.68e-107	353	1097	0.226	0.150	CCNT_DROME Cyclin-T OS=Drosophila melanogaster OX=7227 GN=CycT PE=1 SV=2
7	D3ZC98	4.05e-100	324	663	0.204	0.225	D3ZC98_RAT Cyclin T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=3 SV=1
8	A0A8I6G622	2.45e-80	256	181	0.164	0.663	A0A8I6G622_RAT Cyclin T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=1 SV=1
9	Q8GYM6	2.02e-40	158	541	0.118	0.159	CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-4 PE=1 SV=1
10	Q961D1	9.13e-38	147	400	0.108	0.198	Q961D1_DROME Cyclin K, isoform A OS=Drosophila melanogaster OX=7227 GN=CycK PE=1 SV=1
11	F4KD43	3.53e-37	149	590	0.118	0.146	F4KD43_ARATH Cyclin family protein OS=Arabidopsis thaliana OX=3702 GN=CYCT1:5 PE=1 SV=1
12	O88874	5.48e-36	145	554	0.104	0.137	CCNK_MOUSE Cyclin-K OS=Mus musculus OX=10090 GN=Ccnk PE=1 SV=3
13	O75909	1.09e-35	145	580	0.104	0.131	CCNK_HUMAN Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2
14	G3V5E1	1.34e-35	140	378	0.104	0.201	G3V5E1_HUMAN Cyclin K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=1
15	F1QMB9	3.27e-34	138	425	0.104	0.179	CCNK_DANRE Cyclin-K OS=Danio rerio OX=7955 GN=ccnk PE=2 SV=3
16	G3V2Q3	3.21e-31	124	227	0.093	0.300	G3V2Q3_HUMAN Cyclin K (Fragment) OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=1
17	Q8LBC0	3.67e-31	126	317	0.108	0.249	CCT13_ARATH Cyclin-T1-3 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-3 PE=1 SV=2
18	P34425	4.53e-30	126	468	0.108	0.169	CCNT1_CAEEL Cyclin-T1.1 OS=Caenorhabditis elegans OX=6239 GN=cit-1.1 PE=3 SV=1
19	O74627	4.93e-27	115	342	0.097	0.208	CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pch1 PE=1 SV=1
20	Q8RWV3	5.14e-27	116	416	0.093	0.163	CCL11_ARATH Cyclin-L1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCL1-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00134 Cyclin_N	1.1e-16	72.1	Cyclin, N-terminal domain
2	PF00382 TFIIB	48	15.4	Transcription factor TFIIB repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362361	0.999	Cyclin-dependent kinase 9
2	9606.ENSP00000265343	0.984	AF4/FMR2 family member 4
3	9606.ENSP00000328773	0.980	Protein HEXIM1
4	9606.ENSP00000256443	0.972	Cyclin-dependent kinase 7
5	9606.ENSP00000328901	0.958	General transcription factor IIH subunit 2
6	9606.ENSP00000256897	0.957	Cyclin-H
7	9606.ENSP00000285398	0.948	TFIIH basal transcription factor complex helicase XPB subunit
8	9606.ENSP00000261245	0.943	CDK-activating kinase assembly factor MAT1
9	9606.ENSP00000266970	0.943	Cyclin-dependent kinase 2
10	9606.ENSP00000265963	0.941	General transcription factor IIH subunit 1
11	9606.ENSP00000378699	0.940	Cyclin-dependent kinase 1
12	9606.ENSP00000445162	0.937	General transcription factor IIH subunit 3
13	9606.ENSP00000259895	0.931	General transcription factor IIH subunit 4
14	9606.ENSP00000274026	0.929	Cyclin-A2
15	9606.ENSP00000257904	0.925	Cyclin-dependent kinase 4
16	9606.ENSP00000375809	0.925	TFIIH basal transcription factor complex helicase XPD subunit
17	9606.ENSP00000262643	0.924	G1/S-specific cyclin-E1
18	9606.ENSP00000429089	0.924	G1/S-specific cyclin-E2
19	9606.ENSP00000255465	0.922	Cyclin-A1
20	9606.ENSP00000369390	0.922	Cyclin-dependent kinase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	0.999	transcription factor binding
GO:0070063	0.999	RNA polymerase binding
GO:0017069	0.999	snRNA binding
GO:0019901	0.995	protein kinase binding
GO:0001223	0.988	transcription coactivator binding
GO:0097322	0.749	7SK snRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0044238	0.976	primary metabolic process
GO:0050794	0.975	regulation of cellular process
GO:0071704	0.972	organic substance metabolic process
GO:0044237	0.970	cellular metabolic process
GO:0006807	0.965	nitrogen compound metabolic process
GO:0006366	0.959	transcription by RNA polymerase II
GO:0080090	0.957	regulation of primary metabolic process
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0031323	0.957	regulation of cellular metabolic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0036211	0.927	protein modification process
GO:0048522	0.925	positive regulation of cellular process
GO:0000079	0.922	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0006355	0.905	regulation of DNA-templated transcription
GO:0010604	0.903	positive regulation of macromolecule metabolic process
GO:0031325	0.900	positive regulation of cellular metabolic process
GO:0051173	0.885	positive regulation of nitrogen compound metabolic process
GO:0006357	0.871	regulation of transcription by RNA polymerase II
GO:0045935	0.867	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.861	positive regulation of RNA metabolic process
GO:0032784	0.838	regulation of DNA-templated transcription elongation
GO:0045893	0.835	positive regulation of DNA-templated transcription
GO:0045944	0.826	positive regulation of transcription by RNA polymerase II
GO:0016310	0.760	phosphorylation
GO:0034243	0.758	regulation of transcription elongation by RNA polymerase II
GO:0032786	0.674	positive regulation of DNA-templated transcription, elongation
GO:0032968	0.650	positive regulation of transcription elongation by RNA polymerase II
GO:0006468	0.309	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0140513	0.996	nuclear protein-containing complex
GO:0061695	0.993	transferase complex, transferring phosphorus-containing groups
GO:0005829	0.991	cytosol
GO:1902554	0.982	serine/threonine protein kinase complex
GO:0016020	0.946	membrane
GO:0000307	0.944	cyclin-dependent protein kinase holoenzyme complex
GO:0008023	0.941	transcription elongation factor complex
GO:0005886	0.906	plasma membrane
GO:0032806	0.810	carboxy-terminal domain protein kinase complex
GO:0019908	0.749	nuclear cyclin-dependent protein kinase holoenzyme complex
GO:0008024	0.497	cyclin/CDK positive transcription elongation factor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]