StarFunc result for job id O60603

User Input

>input (784 residues)
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60603	1.000	1.000	0.000	784	1.000	1.000	O60603.pdb.gz	TLR2_HUMAN Toll-like receptor 2 OS=Homo sapiens OX=9606 GN=TLR2 PE=1 SV=1
2	AFDB:E9PTD9	0.755	0.755	1.297E-93	784	0.716	0.716	E9PTD9.pdb.gz	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
3	AFDB:Q9QUN7	0.763	0.763	1.947E-93	784	0.705	0.705	Q9QUN7.pdb.gz	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
4	AFDB:Q9DD78	0.788	0.779	7.613E-78	793	0.526	0.520	Q9DD78.pdb.gz	TLR21_CHICK Toll-like receptor 2 type-1 OS=Gallus gallus OX=9031 GN=TLR2-1 PE=2 SV=1
5	AFDB:F1QWS9	0.675	0.649	3.111E-64	818	0.413	0.396	F1QWS9.pdb.gz	F1QWS9_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=3 SV=1
6	AFDB:F6SU23	0.592	0.573	1.598E-45	818	0.298	0.286	F6SU23.pdb.gz
7	AFDB:Q9BXR5	0.601	0.584	4.514E-45	811	0.298	0.289	Q9BXR5.pdb.gz	TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens OX=9606 GN=TLR10 PE=1 SV=2
8	AFDB:Q15399	0.639	0.637	6.196E-44	786	0.297	0.296	Q15399.pdb.gz	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3
9	AFDB:Q9EPQ1	0.663	0.654	1.831E-43	795	0.297	0.293	Q9EPQ1.pdb.gz	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
10	AFDB:G3V695	0.756	0.734	1.115E-42	811	0.302	0.292	G3V695.pdb.gz	G3V695_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
11	PDB:3j0aA	0.362	0.358	2.657E-24	797	0.207	0.203	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
12	PDB:7wv3A	0.410	0.462	4.387E-16	668	0.158	0.186	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:3t6qA	0.431	0.536	1.357E-15	601	0.159	0.208	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:3b2dA	0.414	0.512	1.187E-12	601	0.156	0.203	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:6gffI	0.343	0.449	4.205E-11	551	0.153	0.218	6gffI.pdb.gz
16	PDB:7tvfD	0.310	0.440	2.043E-10	515	0.124	0.188	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
17	PDB:7wrqA	0.315	0.408	2.562E-9	566	0.143	0.198	7wrqA.pdb.gz
18	PDB:6hkwA	0.219	0.416	6.325E-8	306	0.092	0.235	6hkwA.pdb.gz
19	PDB:1xcdA	0.173	0.410	7.247E-7	305	0.094	0.243	1xcdA.pdb.gz
20	PDB:1a4yA	0.246	0.349	1.191E-6	460	0.087	0.148	1a4yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PTD9	0.0	1114	784	0.717	0.717	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
2	F1QWS9	0.0	568	818	0.413	0.396	F1QWS9_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=3 SV=1
3	O60603	0.0	1606	784	1.000	1.000	TLR2_HUMAN Toll-like receptor 2 OS=Homo sapiens OX=9606 GN=TLR2 PE=1 SV=1
4	Q6TS42	0.0	569	788	0.415	0.412	Q6TS42_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=2 SV=1
5	Q6YGU2	0.0	1115	784	0.717	0.717	Q6YGU2_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=2 SV=1
6	Q9DD78	0.0	831	793	0.523	0.517	TLR21_CHICK Toll-like receptor 2 type-1 OS=Gallus gallus OX=9031 GN=TLR2-1 PE=2 SV=1
7	Q9QUN7	0.0	1148	784	0.709	0.709	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
8	A0A096MKA9	2.95e-105	343	806	0.312	0.304	A0A096MKA9_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
9	Q6P690	3.79e-105	343	806	0.312	0.304	Q6P690_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=2 SV=1
10	Q15399	3.68e-103	337	786	0.291	0.290	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3
11	Q9Y2C9	5.52e-103	337	796	0.316	0.312	TLR6_HUMAN Toll-like receptor 6 OS=Homo sapiens OX=9606 GN=TLR6 PE=1 SV=2
12	Q9BXR5	1.08e-101	334	811	0.307	0.297	TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens OX=9606 GN=TLR10 PE=1 SV=2
13	E9PTL5	1.31e-100	331	808	0.310	0.301	E9PTL5_RAT Toll-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Tlr1 PE=3 SV=3
14	G3V695	2.40e-100	330	811	0.307	0.297	G3V695_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
15	Q9EPQ1	3.09e-97	322	795	0.304	0.299	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
16	Q5WA51	1.89e-96	320	818	0.323	0.309	Q5WA51_CHICK Toll-like receptor 1 OS=Gallus gallus OX=9031 GN=TLR1 PE=2 SV=1
17	Q9EPW9	6.78e-93	310	795	0.314	0.309	TLR6_MOUSE Toll-like receptor 6 OS=Mus musculus OX=10090 GN=Tlr6 PE=1 SV=2
18	A5H0S2	6.61e-85	285	652	0.237	0.285	A5H0S2_CHICK Toll-like receptor 1-like protein b OS=Gallus gallus OX=9031 GN=TLR1Lb PE=2 SV=1
19	Q2XQ10	9.03e-68	243	868	0.205	0.185	Q2XQ10_CHICK Toll-like receptor 2 OS=Gallus gallus OX=9031 GN=TLR15 PE=2 SV=1
20	A0A2R8RTN4	2.76e-47	183	955	0.293	0.241	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	0.71	21.6	Leucine rich repeat C-terminal domain
2	PF00560 LRR_1	0.012	26.8	Leucine Rich Repeat
3	PF12799 LRR_4	4.8e-16	69.8	Leucine Rich repeats (2 copies)
4	PF13306 LRR_5	0.0013	30.1	BspA type Leucine rich repeat region (6 copies)
5	PF13855 LRR_8	9.4e-32	119.9	Leucine rich repeat
6	PF14580 LRR_9	0.00013	33.0	Leucine-rich repeat
7	PF01582 TIR	5.4e-18	76.9	TIR domain
8	PF13676 TIR_2	4e-11	55.0	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260010

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345347	0.999	High mobility group protein B1
2	9606.ENSP00000376445	0.999	Toll/interleukin-1 receptor domain-containing adapter protein
3	9606.ENSP00000265077	0.998	Versican core protein
4	9606.ENSP00000373620	0.998	60 kDa heat shock protein, mitochondrial
5	9606.ENSP00000284818	0.997	Lymphocyte antigen 96
6	9606.ENSP00000304236	0.997	Monocyte differentiation antigen CD14
7	9606.ENSP00000314733	0.997	Toll-interacting protein
8	9606.ENSP00000358997	0.995	Interleukin-1 receptor-associated kinase 1
9	9606.ENSP00000302569	0.994	C-type lectin domain family 7 member A
10	9606.ENSP00000299767	0.989	Endoplasmin
11	9606.ENSP00000302961	0.989	Heat shock protein family A member 4
12	9606.ENSP00000401399	0.989	Myeloid differentiation primary response protein MyD88
13	9606.ENSP00000347197	0.987	C5a anaphylatoxin chemotactic receptor 1
14	9606.ENSP00000390651	0.986	Interleukin-1 receptor-associated kinase 4
15	9606.ENSP00000300589	0.985	Nucleotide-binding oligomerization domain-containing protein 2
16	9606.ENSP00000354932	0.985	Toll-like receptor 1
17	9606.ENSP00000364802	0.985	Heat shock 70 kDa protein 1A
18	9606.ENSP00000433623	0.984	TNF receptor-associated factor 6
19	9606.ENSP00000254301	0.979	Galectin-3
20	9606.ENSP00000386884	0.976	C-X-C chemokine receptor type 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0008289	1.000	lipid binding
GO:0042802	0.997	identical protein binding
GO:0001540	0.997	amyloid-beta binding
GO:0005102	0.985	signaling receptor binding
GO:0097367	0.696	carbohydrate derivative binding
GO:0071723	0.631	lipopeptide binding
GO:0044877	0.575	protein-containing complex binding
GO:0038187	0.566	pattern recognition receptor activity
GO:0001530	0.566	lipopolysaccharide binding
GO:0005539	0.509	glycosaminoglycan binding
GO:0042834	0.470	peptidoglycan binding
GO:0035325	0.378	Toll-like receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0007165	0.993	signal transduction
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0032101	0.989	regulation of response to external stimulus
GO:0009893	0.988	positive regulation of metabolic process
GO:0051239	0.985	regulation of multicellular organismal process
GO:0048522	0.985	positive regulation of cellular process
GO:0010468	0.984	regulation of gene expression
GO:0009605	0.982	response to external stimulus
GO:0010604	0.981	positive regulation of macromolecule metabolic process
GO:0010033	0.979	response to organic substance
GO:0050778	0.979	positive regulation of immune response
GO:0006950	0.977	response to stress
GO:0031347	0.975	regulation of defense response
GO:0032103	0.971	positive regulation of response to external stimulus
GO:0002253	0.969	activation of immune response
GO:0023051	0.964	regulation of signaling
GO:0010646	0.964	regulation of cell communication
GO:0001817	0.963	regulation of cytokine production
GO:0010628	0.960	positive regulation of gene expression
GO:0002224	0.960	toll-like receptor signaling pathway
GO:0032501	0.958	multicellular organismal process
GO:0002237	0.943	response to molecule of bacterial origin
GO:0001819	0.936	positive regulation of cytokine production
GO:0006955	0.928	immune response
GO:0032675	0.922	regulation of interleukin-6 production
GO:0006952	0.917	defense response
GO:0008152	0.912	metabolic process
GO:0010647	0.883	positive regulation of cell communication
GO:0006954	0.876	inflammatory response
GO:0023056	0.876	positive regulation of signaling
GO:0009966	0.872	regulation of signal transduction
GO:0071704	0.864	organic substance metabolic process
GO:0009967	0.856	positive regulation of signal transduction
GO:1902531	0.839	regulation of intracellular signal transduction
GO:0044238	0.837	primary metabolic process
GO:0048519	0.834	negative regulation of biological process
GO:0044237	0.829	cellular metabolic process
GO:0050727	0.818	regulation of inflammatory response
GO:0006807	0.816	nitrogen compound metabolic process
GO:1901700	0.807	response to oxygen-containing compound
GO:1902533	0.795	positive regulation of intracellular signal transduction
GO:0080090	0.771	regulation of primary metabolic process
GO:0051171	0.765	regulation of nitrogen compound metabolic process
GO:0031323	0.765	regulation of cellular metabolic process
GO:0071310	0.752	cellular response to organic substance
GO:0032755	0.752	positive regulation of interleukin-6 production
GO:0044093	0.738	positive regulation of molecular function
GO:0071216	0.703	cellular response to biotic stimulus
GO:0009889	0.700	regulation of biosynthetic process
GO:0098542	0.696	defense response to other organism
GO:0032680	0.686	regulation of tumor necrosis factor production
GO:0006355	0.686	regulation of DNA-templated transcription
GO:0071219	0.675	cellular response to molecule of bacterial origin
GO:0010243	0.657	response to organonitrogen compound
GO:0032652	0.655	regulation of interleukin-1 production
GO:0050729	0.637	positive regulation of inflammatory response
GO:0032642	0.608	regulation of chemokine production
GO:0032677	0.607	regulation of interleukin-8 production
GO:2001057	0.568	reactive nitrogen species metabolic process
GO:0032722	0.568	positive regulation of chemokine production
GO:0007166	0.535	cell surface receptor signaling pathway
GO:0032757	0.528	positive regulation of interleukin-8 production
GO:1901224	0.527	positive regulation of NIK/NF-kappaB signaling
GO:0046209	0.504	nitric oxide metabolic process
GO:0051173	0.456	positive regulation of nitrogen compound metabolic process
GO:0031325	0.444	positive regulation of cellular metabolic process
GO:0048523	0.434	negative regulation of cellular process
GO:0062207	0.413	regulation of pattern recognition receptor signaling pathway
GO:0009595	0.412	detection of biotic stimulus
GO:0098581	0.398	detection of external biotic stimulus
GO:1901701	0.385	cellular response to oxygen-containing compound
GO:0062208	0.384	positive regulation of pattern recognition receptor signaling pathway
GO:0048856	0.355	anatomical structure development
GO:0051246	0.347	regulation of protein metabolic process
GO:0051241	0.319	negative regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.987	protein-containing complex
GO:0009986	0.956	cell surface
GO:0043227	0.951	membrane-bounded organelle
GO:0005737	0.939	cytoplasm
GO:0012505	0.921	endomembrane system
GO:0043231	0.901	intracellular membrane-bounded organelle
GO:0031982	0.705	vesicle
GO:0043235	0.582	receptor complex
GO:0097708	0.455	intracellular vesicle
GO:0031410	0.451	cytoplasmic vesicle
GO:0098796	0.364	membrane protein complex
GO:0030141	0.339	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]