StarFunc result for job id O60610

User Input

>input (1272 residues)
MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKE
KEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIII
KREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWV
QTFGAEGLASLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEG
ILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLD
GLKSGTTIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENEDMRV
QLNVFDEQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLV
RNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAK
AAELEKKLDSELTARHELQVEMKKMESDFEQKLQDLQGEKDALHSEKQQIATEKQDLEAE
VSQLTGEVAKLTKELEDAKKEMASLSAAAITVPPSVPSRAPVPPAPPLPGDSGTIIPPPP
APGDSTTPPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLPEG
VGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPL
PGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLTPKKLYKPEVQLR
RPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKS
VQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPE
PEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSV
TAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLL
HFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAAT
DEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHN
FRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMD
SLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTI
LEEAKELVGRAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60610	1.000	1.000	0.000	1272	1.000	1.000	O60610.pdb.gz	DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2
2	AFDB:F1RMT5	0.258	0.398	2.660E-66	808	0.550	0.866	F1RMT5.pdb.gz	F1RMT5_PIG Diaphanous related formin 1 OS=Sus scrofa OX=9823 GN=DIAPH1 PE=1 SV=5
3	AFDB:Q54SP2	0.245	0.275	1.922E-33	1126	0.210	0.237	Q54SP2.pdb.gz	FORB_DICDI Formin-B OS=Dictyostelium discoideum OX=44689 GN=forB PE=1 SV=1
4	AFDB:Q9SE97	0.249	0.296	3.744E-18	1051	0.129	0.156	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
5	AFDB:Q9C0D6	0.237	0.262	3.601E-16	1143	0.116	0.129	Q9C0D6.pdb.gz	FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2
6	AFDB:Q3ULZ2	0.229	0.252	1.822E-15	1149	0.125	0.138	Q3ULZ2.pdb.gz	FHDC1_MOUSE FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhdc1 PE=1 SV=3
7	AFDB:Q8GX37	0.222	0.349	2.680E-14	782	0.105	0.170	Q8GX37.pdb.gz	FH9_ARATH Formin-like protein 9 OS=Arabidopsis thaliana OX=3702 GN=FH9 PE=2 SV=2
8	AFDB:Q9FF14	0.224	0.573	6.866E-13	464	0.095	0.261	Q9FF14.pdb.gz	FH19_ARATH Formin-like protein 19 OS=Arabidopsis thaliana OX=3702 GN=FH19 PE=2 SV=1
9	PDB:7sn8D	0.079	0.161	9.446E-3	399	0.042	0.133	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
10	PDB:3gniA	0.107	0.268	3.120E-2	335	0.031	0.119	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
11	PDB:2x1gF	0.136	0.181	3.862E-2	896	0.038	0.054	2x1gF.pdb.gz
12	PDB:3zhpA	0.130	0.402	4.206E-2	315	0.031	0.124	3zhpA.pdb.gz
13	PDB:4hm9A	0.142	0.315	1.222E-1	511	0.043	0.108	4hm9A.pdb.gz
14	PDB:6swy5	0.126	0.193	1.331E-1	789	0.032	0.052	6swy5.pdb.gz
15	PDB:7unkA	0.103	0.118	1.450E-1	1047	0.050	0.060	7unkA.pdb.gz
16	PDB:1qgkA	0.129	0.179	1.579E-1	876	0.046	0.066	1qgkA.pdb.gz
17	PDB:7anwA	0.133	0.242	1.648E-1	645	0.023	0.045	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
18	PDB:5tbkA	0.085	0.176	1.720E-1	417	0.039	0.120	5tbkA.pdb.gz
19	AFDB:Q38EY5	0.056	0.040	1.950E-1	2147	0.099	0.059	Q38EY5.pdb.gz	Q38EY5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4210 PE=4 SV=1
20	AFDB:A0A0S2Z4Q4	0.079	0.121	2.124E-1	699	0.075	0.136	A0A0S2Z4Q4.pdb.gz	A0A0S2Z4Q4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M775	0.0	961	1265	0.398	0.400	DIAP1_RAT Protein diaphanous homolog 1 OS=Rattus norvegicus OX=10116 GN=Diaph1 PE=1 SV=3
2	F1RMT5	0.0	1030	850	0.407	0.609	F1RMT5_PIG Diaphanous related formin 1 OS=Sus scrofa OX=9823 GN=DIAPH1 PE=1 SV=5
3	O08808	0.0	966	1255	0.391	0.396	DIAP1_MOUSE Protein diaphanous homolog 1 OS=Mus musculus OX=10090 GN=Diaph1 PE=1 SV=1
4	O60610	0.0	2573	1272	1.000	1.000	DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2
5	O60879	0.0	623	1101	0.236	0.272	DIAP2_HUMAN Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1
6	O70566	0.0	579	1098	0.246	0.285	DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2
7	Q9Z207	2.19e-173	547	1171	0.212	0.231	DIAP3_MOUSE Protein diaphanous homolog 3 OS=Mus musculus OX=10090 GN=Diaph3 PE=1 SV=1
8	F1LVW7	1.12e-166	530	1172	0.223	0.242	DIAP3_RAT Protein diaphanous homolog 3 OS=Rattus norvegicus OX=10116 GN=Diaph3 PE=1 SV=4
9	Q9NSV4	5.76e-163	520	1193	0.216	0.231	DIAP3_HUMAN Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4
10	P48608	2.95e-102	352	1091	0.160	0.187	DIA_DROME Protein diaphanous OS=Drosophila melanogaster OX=7227 GN=dia PE=2 SV=2
11	A0A1D5P556	2.56e-49	193	1075	0.119	0.140	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
12	Q8BPM0	2.92e-48	190	1077	0.116	0.137	DAAM1_MOUSE Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4
13	Q54N00	1.94e-47	187	1087	0.114	0.133	FORH_DICDI Formin-H OS=Dictyostelium discoideum OX=44689 GN=forH PE=1 SV=1
14	Q80U19	7.35e-47	186	1115	0.098	0.112	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
15	Q54WH2	3.93e-46	184	1218	0.105	0.109	FORA_DICDI Formin-A OS=Dictyostelium discoideum OX=44689 GN=forA PE=1 SV=1
16	Q8IRY0	6.21e-46	183	1153	0.109	0.121	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
17	M9MSM5	8.25e-46	183	1463	0.111	0.096	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
18	H2KYI3	9.00e-46	183	1435	0.137	0.121	H2KYI3_CAEEL WAPL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cyk-1 PE=1 SV=2
19	Q7JP75	9.49e-46	183	1437	0.137	0.121	Q7JP75_CAEEL WAPL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cyk-1 PE=1 SV=2
20	Q7YZA4	1.19e-45	182	1114	0.111	0.127	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04513 Baculo_PEP_C	65	15.0	Baculovirus polyhedron envelope protein, PEP, C terminus
2	PF06345 Drf_DAD	0.12	23.3	DRF Autoregulatory Domain
3	PF06346 Drf_FH1	9.3e-37	137.8	Formin Homology Region 1
4	PF06367 Drf_FH3	1.2e-53	193.2	Diaphanous FH3 Domain
5	PF06371 Drf_GBD	3.4e-38	142.7	Diaphanous GTPase-binding Domain
6	PF11932 DUF3450	2.2	19.1	Protein of unknown function (DUF3450)
7	PF06103 DUF948	3e+02	13.1	Bacterial protein of unknown function (DUF948)
8	PF02181 FH2	5.2e-114	392.9	Formin Homology 2 Domain
9	PF02364 Glucan_synthase	3.6e+02	10.7	1,3-beta-glucan synthase component

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.998	Transforming protein RhoA
2	9606.ENSP00000383178	0.972	Protein diaphanous homolog 3
3	9606.ENSP00000268182	0.966	Ras GTPase-activating-like protein IQGAP1
4	9606.ENSP00000225655	0.962	Profilin-1
5	9606.ENSP00000364210	0.931	Advanced glycosylation end product-specific receptor
6	9606.ENSP00000365312	0.925	Abl interactor 1
7	9606.ENSP00000444645	0.920	Cytoplasmic FMR1-interacting protein 2
8	9606.ENSP00000355645	0.915	Actin, alpha skeletal muscle
9	9606.ENSP00000347847	0.914	MKL/myocardin-like protein 1
10	9606.ENSP00000354251	0.913	Nck-associated protein 1
11	9606.ENSP00000285735	0.912	Rho-related GTP-binding protein RhoC
12	9606.ENSP00000310880	0.900	Myelin and lymphocyte protein
13	9606.ENSP00000349960	0.891	Actin, cytoplasmic 1
14	9606.ENSP00000383118	0.877	Cell division control protein 42 homolog
15	9606.ENSP00000321348	0.866	Protein diaphanous homolog 2
16	9606.ENSP00000322170	0.861	Profilin-4
17	9606.ENSP00000272233	0.853	Rho-related GTP-binding protein RhoB
18	9606.ENSP00000458162	0.852	Actin, cytoplasmic 2
19	9606.ENSP00000308576	0.830	Rho-related GTP-binding protein RhoD
20	9606.ENSP00000351379	0.821	Profilin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	0.999	transmembrane transporter binding
GO:0097159	0.985	organic cyclic compound binding
GO:1901363	0.980	heterocyclic compound binding
GO:0003676	0.930	nucleic acid binding
GO:0003723	0.919	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0071840	0.968	cellular component organization or biogenesis
GO:0016043	0.955	cellular component organization
GO:0050896	0.939	response to stimulus
GO:0032501	0.938	multicellular organismal process
GO:0051179	0.933	localization
GO:0007010	0.918	cytoskeleton organization
GO:0048518	0.903	positive regulation of biological process
GO:0051128	0.882	regulation of cellular component organization
GO:0048522	0.874	positive regulation of cellular process
GO:0030036	0.771	actin cytoskeleton organization
GO:0033043	0.703	regulation of organelle organization
GO:0051716	0.694	cellular response to stimulus
GO:0032502	0.633	developmental process
GO:0048856	0.624	anatomical structure development
GO:0032879	0.571	regulation of localization
GO:0051641	0.500	cellular localization
GO:0042221	0.463	response to chemical
GO:0050793	0.428	regulation of developmental process
GO:0040012	0.410	regulation of locomotion
GO:0051493	0.395	regulation of cytoskeleton organization
GO:0022607	0.393	cellular component assembly
GO:0051049	0.369	regulation of transport
GO:0007275	0.362	multicellular organism development
GO:0051234	0.321	establishment of localization
GO:0010033	0.302	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0071944	0.997	cell periphery
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0005886	0.991	plasma membrane
GO:0005829	0.987	cytosol
GO:0005856	0.985	cytoskeleton
GO:0031982	0.961	vesicle
GO:0031090	0.949	organelle membrane
GO:0031410	0.929	cytoplasmic vesicle
GO:0005634	0.920	nucleus
GO:0120025	0.779	plasma membrane bounded cell projection
GO:0015630	0.738	microtubule cytoskeleton
GO:0098588	0.724	bounding membrane of organelle
GO:0030659	0.699	cytoplasmic vesicle membrane
GO:0030141	0.698	secretory granule
GO:0005576	0.642	extracellular region
GO:1903561	0.626	extracellular vesicle
GO:0070062	0.608	extracellular exosome
GO:0072686	0.529	mitotic spindle
GO:0101002	0.480	ficolin-1-rich granule
GO:0030667	0.451	secretory granule membrane
GO:0101003	0.391	ficolin-1-rich granule membrane
GO:0070013	0.345	intracellular organelle lumen
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]