StarFunc result for job id O60641

User Input

>input (907 residues)
MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMA
DTLFERATNSSWVVVFKALVTTHHLMVHGNERFIQYLASRNTLFNLSNFLDKSGSHGYDM
STFIRRYSRYLNEKAFSYRQMAFDFARVKKGADGVMRTMAPEKLLKSMPILQGQIDALLE
FDVHPNELTNGVINAAFMLLFKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRF
LTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLMETLEQHLNTLEGKKPGNNEGSGAPS
PLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLLDLQPDFSSGG
AAAAAAPAPPPPAGGATAWGDLLGEDSLAALSSVPSEAQISDPFAPEPTPPTTTAEIATA
SASASTTTTVTAVTAEVDLFGDAFAASPGEAPAASEGAAAPATPTPVAAALDACSGNDPF
APSEGSAEAAPELDLFAMKPPETSVPVVTPTASTAPPVPATAPSPAPAVAAAAAATTAAT
AAATTTTTTSAATATTAPPALDIFGDLFESTPEVAAAPKPDAAPSIDLFSTDAFSSPPQG
ASPVPESSLTADLLSVDAFAAPSPATTASPAKVDSSGVIDLFGDAFGSSASEPQPASQAA
SSSSASADLLAGFGGSFMAPSPSPVTPAQNNLLQPNFEAAFGTTPSTSSSSSFDPSVFDG
LGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDSSLASLVGNLGISGTTTKKGDL
QWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGF
GMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPASQSPKKPPAKDPLAD
LNIKDFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60641	0.999	0.999	7.000E-89	907	1.000	1.000	O60641.pdb.gz	AP180_HUMAN Clathrin coat assembly protein AP180 OS=Homo sapiens OX=9606 GN=SNAP91 PE=1 SV=2
2	AFDB:Q05140	0.387	0.384	1.438E-79	915	0.925	0.917	Q05140.pdb.gz	AP180_RAT Clathrin coat assembly protein AP180 OS=Rattus norvegicus OX=10116 GN=Snap91 PE=1 SV=1
3	AFDB:Q7M6Y3	0.301	0.413	1.747E-37	660	0.413	0.568	Q7M6Y3.pdb.gz	PICAL_MOUSE Phosphatidylinositol-binding clathrin assembly protein OS=Mus musculus OX=10090 GN=Picalm PE=1 SV=1
4	AFDB:A0A024R5L7	0.317	0.471	2.763E-36	610	0.388	0.577	A0A024R5L7.pdb.gz
5	AFDB:Q54Y50	0.283	0.368	8.031E-19	695	0.173	0.226	Q54Y50.pdb.gz	Q54Y50_DICDI ANTH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=clmA PE=4 SV=1
6	AFDB:Q67YI9	0.117	0.118	6.326E-4	895	0.194	0.197	Q67YI9.pdb.gz	EPN2_ARATH Clathrin interactor EPSIN 2 OS=Arabidopsis thaliana OX=3702 GN=EPSIN2 PE=1 SV=1
7	AFDB:Q93YP4	0.116	0.104	1.860E-3	1024	0.174	0.154	Q93YP4.pdb.gz	EPN3_ARATH Clathrin interactor EPSIN 3 OS=Arabidopsis thaliana OX=3702 GN=EPSIN3 PE=2 SV=1
8	AFDB:B3DI22	0.091	0.076	2.211E-3	1130	0.138	0.111	B3DI22.pdb.gz	B3DI22_DANRE Nonsense-mediated mRNA decay factor OS=Danio rerio OX=7955 GN=wu:fa99h10 PE=1 SV=1
9	AFDB:Q9M658	0.065	0.037	2.410E-3	2001	0.165	0.075	Q9M658.pdb.gz	MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana OX=3702 GN=MOM1 PE=1 SV=1
10	AFDB:A0A0B4K822	0.053	0.044	3.122E-3	1136	0.175	0.140	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
11	PDB:7cunG	0.099	0.100	5.681E-2	895	0.035	0.036	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
12	PDB:2z6gA	0.110	0.156	9.131E-2	550	0.050	0.082	2z6gA.pdb.gz
13	PDB:4tnmA	0.109	0.205	9.954E-2	407	0.040	0.088	4tnmA.pdb.gz
14	PDB:3gniA	0.103	0.190	1.468E-1	335	0.046	0.125	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
15	PDB:1b3uA	0.101	0.135	1.600E-1	588	0.037	0.058	1b3uA.pdb.gz
16	PDB:6wb92	0.068	0.129	1.600E-1	292	0.036	0.113	6wb92.pdb.gz
17	PDB:3nd2A	0.108	0.113	2.164E-1	861	0.039	0.041	3nd2A.pdb.gz
18	PDB:1wa5B	0.107	0.174	2.463E-1	466	0.037	0.073	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
19	PDB:2q5dB	0.106	0.111	2.463E-1	845	0.036	0.039	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
20	PDB:7dkhI	0.078	0.078	2.463E-1	914	0.040	0.039	7dkhI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7Z073	0.0	1451	900	0.932	0.939	A7Z073_BOVIN SNAP91 protein OS=Bos taurus OX=9913 GN=SNAP91 PE=2 SV=1
2	O55012	0.0	544	640	0.301	0.427	PICAL_RAT Phosphatidylinositol-binding clathrin assembly protein OS=Rattus norvegicus OX=10116 GN=Picalm PE=1 SV=1
3	O60641	0.0	1788	907	1.000	1.000	AP180_HUMAN Clathrin coat assembly protein AP180 OS=Homo sapiens OX=9606 GN=SNAP91 PE=1 SV=2
4	Q05140	0.0	1413	915	0.904	0.896	AP180_RAT Clathrin coat assembly protein AP180 OS=Rattus norvegicus OX=10116 GN=Snap91 PE=1 SV=1
5	Q61548	0.0	1443	901	0.914	0.920	AP180_MOUSE Clathrin coat assembly protein AP180 OS=Mus musculus OX=10090 GN=Snap91 PE=1 SV=1
6	Q7M6Y3	0.0	546	660	0.302	0.415	PICAL_MOUSE Phosphatidylinositol-binding clathrin assembly protein OS=Mus musculus OX=10090 GN=Picalm PE=1 SV=1
7	Q13492	2.66e-180	537	652	0.299	0.416	PICAL_HUMAN Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM PE=1 SV=2
8	Q9VI75	4.88e-149	450	468	0.233	0.451	PICAL_DROME Phosphatidylinositol-binding clathrin assembly protein LAP OS=Drosophila melanogaster OX=7227 GN=lap PE=1 SV=3
9	Q9U6M6	5.00e-145	449	751	0.219	0.265	Q9U6M6_DORPE Clathrin assembly protein AP180 OS=Doryteuthis pealeii OX=1051067 GN=AP180 PE=2 SV=1
10	Q9XZI6	4.26e-132	410	586	0.201	0.311	PICAL_CAEEL Phosphatidylinositol-binding clathrin assembly protein unc-11 OS=Caenorhabditis elegans OX=6239 GN=unc-11 PE=1 SV=1
11	Q54Y50	4.01e-46	179	695	0.106	0.138	Q54Y50_DICDI ANTH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=clmA PE=4 SV=1
12	O60167	1.16e-32	137	649	0.099	0.139	YHC3_SCHPO ENTH domain-containing protein C19F8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19F8.03c PE=1 SV=1
13	P94017	2.69e-31	133	692	0.090	0.118	CAP9_ARATH Putative clathrin assembly protein At1g14910 OS=Arabidopsis thaliana OX=3702 GN=At1g14910 PE=2 SV=2
14	Q8LBH2	6.74e-30	128	571	0.094	0.149	CAP8_ARATH Putative clathrin assembly protein At2g01600 OS=Arabidopsis thaliana OX=3702 GN=At2g01600 PE=2 SV=2
15	Q8VYT2	1.60e-28	124	601	0.085	0.128	CAP6_ARATH Putative clathrin assembly protein At4g25940 OS=Arabidopsis thaliana OX=3702 GN=At4g25940 PE=2 SV=1
16	H0YD48	1.81e-28	117	264	0.096	0.330	H0YD48_HUMAN Phosphatidylinositol binding clathrin assembly protein (Fragment) OS=Homo sapiens OX=9606 GN=PICALM PE=1 SV=1
17	Q9LVD8	1.57e-27	120	591	0.084	0.129	CAP7_ARATH Putative clathrin assembly protein At5g57200 OS=Arabidopsis thaliana OX=3702 GN=At5g57200 PE=3 SV=1
18	P53309	3.03e-26	116	568	0.090	0.144	AP18B_YEAST Clathrin coat assembly protein AP180B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAP1802 PE=1 SV=1
19	P38856	3.65e-24	110	637	0.084	0.119	AP18A_YEAST Clathrin coat assembly protein AP180A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAP1801 PE=1 SV=1
20	Q385T8	1.12e-21	102	492	0.092	0.169	Q385T8_TRYB2 Clathrin coat assembly protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2410 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07651 ANTH	9.5e-81	282.4	ANTH domain
2	PF01417 ENTH	2.3e-11	55.3	ENTH domain
3	PF00790 VHS	2.8e+02	12.8	VHS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253083	0.951	Huntingtin-interacting protein 1-related protein
2	9606.ENSP00000360798	0.941	Epidermal growth factor receptor substrate 15
3	9606.ENSP00000479606	0.925	Clathrin heavy chain 1
4	9606.ENSP00000314214	0.912	Vesicle-associated membrane protein 2
5	9606.ENSP00000348602	0.893	Amphiphysin
6	9606.ENSP00000370719	0.861	Intersectin-1
7	9606.ENSP00000406209	0.856	Epsin-1
8	9606.ENSP00000360108	0.831	Putative tyrosine-protein phosphatase auxilin
9	9606.ENSP00000327694	0.825	AP-2 complex subunit alpha-2
10	9606.ENSP00000054666	0.821	Vesicle-associated membrane protein 3
11	9606.ENSP00000347244	0.811	Intersectin-2
12	9606.ENSP00000409667	0.811	Synaptojanin-1
13	9606.ENSP00000482835	0.802	AP-2 complex subunit beta
14	9606.ENSP00000261205	0.786	Synaptotagmin-1
15	9606.ENSP00000369981	0.780	Endophilin-A1
16	9606.ENSP00000429824	0.778	Clathrin interactor 1
17	9606.ENSP00000263864	0.773	Vesicle-associated membrane protein 8
18	9606.ENSP00000393313	0.769	Epidermal growth factor receptor substrate 15-like 1
19	9606.ENSP00000263233	0.765	Synaptophysin
20	9606.ENSP00000358695	0.743	Cytochrome b5 reductase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030276	0.999	clathrin binding
GO:0005543	0.611	phospholipid binding
GO:0019904	0.445	protein domain specific binding
GO:0035091	0.397	phosphatidylinositol binding
GO:0032050	0.317	clathrin heavy chain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.995	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0051234	0.986	establishment of localization
GO:0016192	0.982	vesicle-mediated transport
GO:0071840	0.969	cellular component organization or biogenesis
GO:0006897	0.966	endocytosis
GO:0051641	0.961	cellular localization
GO:0099003	0.955	vesicle-mediated transport in synapse
GO:0051649	0.954	establishment of localization in cell
GO:0016043	0.950	cellular component organization
GO:0065008	0.909	regulation of biological quality
GO:0032879	0.892	regulation of localization
GO:0051049	0.876	regulation of transport
GO:0051128	0.870	regulation of cellular component organization
GO:0099504	0.837	synaptic vesicle cycle
GO:0140238	0.831	presynaptic endocytosis
GO:0048488	0.799	synaptic vesicle endocytosis
GO:0048518	0.759	positive regulation of biological process
GO:0048522	0.731	positive regulation of cellular process
GO:0030100	0.631	regulation of endocytosis
GO:0051050	0.572	positive regulation of transport
GO:0051130	0.564	positive regulation of cellular component organization
GO:0007154	0.540	cell communication
GO:0023052	0.496	signaling
GO:0032501	0.377	multicellular organismal process
GO:0050896	0.350	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0012505	0.994	endomembrane system
GO:0098590	0.994	plasma membrane region
GO:0031410	0.994	cytoplasmic vesicle
GO:0098793	0.990	presynapse
GO:0019898	0.985	extrinsic component of membrane
GO:0098888	0.984	extrinsic component of presynaptic membrane
GO:0032991	0.982	protein-containing complex
GO:0031090	0.982	organelle membrane
GO:0098588	0.973	bounding membrane of organelle
GO:0098833	0.972	presynaptic endocytic zone
GO:0005829	0.971	cytosol
GO:0030659	0.971	cytoplasmic vesicle membrane
GO:0030136	0.969	clathrin-coated vesicle
GO:0098835	0.947	presynaptic endocytic zone membrane
GO:0120025	0.893	plasma membrane bounded cell projection
GO:0099503	0.880	secretory vesicle
GO:0043005	0.815	neuron projection
GO:0098794	0.807	postsynapse
GO:0030133	0.803	transport vesicle
GO:0008021	0.790	synaptic vesicle
GO:0030424	0.772	axon
GO:0098796	0.770	membrane protein complex
GO:0030139	0.716	endocytic vesicle
GO:0030665	0.693	clathrin-coated vesicle membrane
GO:0030666	0.687	endocytic vesicle membrane
GO:0030132	0.652	clathrin coat of coated pit
GO:0030669	0.608	clathrin-coated endocytic vesicle membrane
GO:0030131	0.601	clathrin adaptor complex
GO:0030128	0.593	clathrin coat of endocytic vesicle
GO:0045211	0.534	postsynaptic membrane
GO:0150034	0.529	distal axon
GO:0060076	0.487	excitatory synapse
GO:0044306	0.486	neuron projection terminus
GO:0005768	0.481	endosome
GO:0036477	0.464	somatodendritic compartment
GO:0044297	0.441	cell body
GO:0005634	0.433	nucleus
GO:0043025	0.416	neuronal cell body
GO:0098685	0.413	Schaffer collateral - CA1 synapse
GO:0030658	0.399	transport vesicle membrane
GO:0043679	0.398	axon terminus
GO:0098850	0.380	extrinsic component of synaptic vesicle membrane
GO:0030130	0.378	clathrin coat of trans-Golgi network vesicle
GO:0030122	0.367	AP-2 adaptor complex
GO:0048786	0.322	presynaptic active zone
GO:0010008	0.318	endosome membrane
GO:0005764	0.316	lysosome
GO:0098984	0.315	neuron to neuron synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]