StarFunc result for job id O60656

User Input

>input (530 residues)
MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLF
FSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEILQTPVT
EYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60656	1.000	1.000	3.474E-102	530	1.000	1.000	O60656.pdb.gz	UD19_HUMAN UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1
2	AFDB:Q64634	0.987	0.987	3.492E-86	530	0.781	0.781	Q64634.pdb.gz	UD18_RAT UDP-glucuronosyltransferase 1A8 OS=Rattus norvegicus OX=10116 GN=Ugt1a8 PE=2 SV=1
3	AFDB:Q64633	0.984	0.982	7.907E-85	531	0.775	0.774	Q64633.pdb.gz	UD17_RAT UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1
4	AFDB:P22309	0.951	0.946	7.150E-74	533	0.674	0.670	P22309.pdb.gz	UD11_HUMAN UDP-glucuronosyltransferase 1A1 OS=Homo sapiens OX=9606 GN=UGT1A1 PE=1 SV=1
5	AFDB:P19224	0.934	0.931	3.055E-73	532	0.691	0.688	P19224.pdb.gz	UD16_HUMAN UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2
6	AFDB:P22310	0.953	0.946	1.237E-72	534	0.679	0.674	P22310.pdb.gz	UD14_HUMAN UDP-glucuronosyltransferase 1A4 OS=Homo sapiens OX=9606 GN=UGT1A4 PE=1 SV=1
7	AFDB:Q63886	0.941	0.933	1.903E-72	535	0.632	0.626	Q63886.pdb.gz	UD11_MOUSE UDP-glucuronosyltransferase 1A1 OS=Mus musculus OX=10090 GN=Ugt1a1 PE=1 SV=2
8	AFDB:Q64638	0.946	0.944	2.627E-72	531	0.626	0.625	Q64638.pdb.gz	UD15_RAT UDP-glucuronosyltransferase 1A5 OS=Rattus norvegicus OX=10116 GN=Ugt1a5 PE=2 SV=1
9	AFDB:P20720	0.938	0.933	5.010E-72	533	0.636	0.632	P20720.pdb.gz	UD12_RAT UDP-glucuronosyltransferase 1-2 OS=Rattus norvegicus OX=10116 GN=Ugt1a2 PE=2 SV=2
10	AFDB:Q64637	0.926	0.925	1.064E-71	531	0.621	0.620	Q64637.pdb.gz	UD13_RAT UDP-glucuronosyltransferase 1A3 OS=Rattus norvegicus OX=10116 GN=Ugt1a3 PE=2 SV=1
11	PDB:6l8xA	0.541	0.627	7.789E-17	450	0.149	0.176	6l8xA.pdb.gz
12	PDB:6llzA	0.558	0.664	1.654E-16	436	0.130	0.158	6llzA.pdb.gz	Crystal Structures of theC-Glycosyltransferase UGT708C1 from Buckwheat Provide Insights into the Mechanism ofC-Glycosylation.
13	PDB:5u6nB	0.484	0.564	1.842E-16	448	0.158	0.188	5u6nB.pdb.gz	Differences in salicylic acid glucose conjugations by UGT74F1 and UGT74F2 from Arabidopsis thaliana.
14	PDB:2c1zA	0.530	0.626	2.989E-16	439	0.147	0.178	2c1zA.pdb.gz	Structure of a Flavonoid Glucosyltransferase Reveals the Basis for Plant Natural Product Modification.
15	PDB:7va8A	0.531	0.609	3.154E-16	456	0.143	0.167	7va8A.pdb.gz	Directed Evolution of a Plant Glycosyltransferase for Chemo- and Regioselective Glycosylation of Pharmaceutically Significant Flavonoids
16	PDB:5tmbA	0.527	0.608	7.068E-16	451	0.153	0.180	5tmbA.pdb.gz	Crystal Structure of Os79 (Os04g0206600) from Oryza sativa: A UDP-glucosyltransferase Involved in the Detoxification of Deoxynivalenol.
17	PDB:2vg8A	0.576	0.648	9.760E-16	465	0.149	0.170	2vg8A.pdb.gz	Characterization and Engineering of the Bifunctional N- and O-Glucosyltransferase Involved in Xenobiotic Metabolism in Plants.
18	PDB:1iirA	0.570	0.766	1.422E-15	382	0.121	0.168	1iirA.pdb.gz
19	PDB:1rrvA	0.547	0.701	1.422E-15	401	0.140	0.185	1rrvA.pdb.gz	Crystal Structure of Vancosaminyltransferase Gtfd from the Vancomycin Biosynthetic Pathway: Interactions with Acceptor and Nucleotide Ligands
20	PDB:6lf6A	0.517	0.589	1.422E-15	457	0.126	0.147	6lf6A.pdb.gz	Dissection of the general two-step di- C -glycosylation pathway for the biosynthesis of (iso)schaftosides in higher plants.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	F1QAF6	548	525	0.498	0.503	F1QAF6_DANRE UDP-glucuronosyltransferase OS=Danio rerio OX=7955 GN=ugt1a1 PE=1 SV=1
2	F1QRI1	527	520	0.472	0.481	F1QRI1_DANRE UDP-glucuronosyltransferase OS=Danio rerio OX=7955 GN=ugt1a6 PE=1 SV=1
3	F1R1P2	552	536	0.487	0.481	F1R1P2_DANRE UDP glucuronosyltransferase 1 family polypeptide a3 precursor OS=Danio rerio OX=7955 GN=ugt1ab PE=1 SV=1
4	O60656	1108	530	1.000	1.000	UD19_HUMAN UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1
5	P08430	684	529	0.638	0.639	UD16_RAT UDP-glucuronosyltransferase 1-6 OS=Rattus norvegicus OX=10116 GN=Ugt1a6 PE=1 SV=1
6	P19224	736	532	0.689	0.686	UD16_HUMAN UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2
7	P20720	695	533	0.628	0.625	UD12_RAT UDP-glucuronosyltransferase 1-2 OS=Rattus norvegicus OX=10116 GN=Ugt1a2 PE=2 SV=2
8	P22309	730	533	0.670	0.666	UD11_HUMAN UDP-glucuronosyltransferase 1A1 OS=Homo sapiens OX=9606 GN=UGT1A1 PE=1 SV=1
9	P22310	729	534	0.668	0.663	UD14_HUMAN UDP-glucuronosyltransferase 1A4 OS=Homo sapiens OX=9606 GN=UGT1A4 PE=1 SV=1
10	P35503	738	534	0.674	0.669	UD13_HUMAN UDP-glucuronosyltransferase 1A3 OS=Homo sapiens OX=9606 GN=UGT1A3 PE=1 SV=1
11	Q13460	526	310	0.485	0.829	Q13460_HUMAN UDP-glucuronosyltransferase OS=Homo sapiens OX=9606 GN=UGT1H PE=4 SV=1
12	Q5DSZ8	736	532	0.689	0.686	Q5DSZ8_HUMAN UDP-glucuronosyltransferase OS=Homo sapiens OX=9606 GN=UGT1A6 PE=2 SV=1
13	Q63886	689	535	0.645	0.639	UD11_MOUSE UDP-glucuronosyltransferase 1A1 OS=Mus musculus OX=10090 GN=Ugt1a1 PE=1 SV=2
14	Q64435	694	531	0.642	0.640	UD16_MOUSE UDP-glucuronosyltransferase 1-6 OS=Mus musculus OX=10090 GN=Ugt1a6 PE=1 SV=1
15	Q64550	687	535	0.625	0.619	UD11_RAT UDP-glucuronosyltransferase 1A1 OS=Rattus norvegicus OX=10116 GN=Ugt1a1 PE=1 SV=1
16	Q64633	831	531	0.760	0.759	UD17_RAT UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1
17	Q64634	874	530	0.781	0.781	UD18_RAT UDP-glucuronosyltransferase 1A8 OS=Rattus norvegicus OX=10116 GN=Ugt1a8 PE=2 SV=1
18	Q64637	673	531	0.611	0.610	UD13_RAT UDP-glucuronosyltransferase 1A3 OS=Rattus norvegicus OX=10116 GN=Ugt1a3 PE=2 SV=1
19	Q64638	680	531	0.619	0.618	UD15_RAT UDP-glucuronosyltransferase 1A5 OS=Rattus norvegicus OX=10116 GN=Ugt1a5 PE=2 SV=1
20	Q95KM4	723	533	0.660	0.657	Q95KM4_MACMU UDP-glucuronosyltransferase OS=Macaca mulatta OX=9544 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04101 Glyco_tran_28_C	2.1e-05	36.1	Glycosyltransferase family 28 C-terminal domain
2	PF00201 UDPGT	2.9e-243	819.8	UDP-glucoronosyl and UDP-glucosyl transferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346768

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416002	0.926	UDP-galactose translocator
2	9606.ENSP00000385523	0.923	Peroxisome proliferator-activated receptor alpha
3	9606.ENSP00000337915	0.919	Cytochrome P450 3A4
4	9606.ENSP00000457466	0.905	Chromodomain-helicase-DNA-binding protein 9
5	9606.ENSP00000262188	0.903	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
6	9606.ENSP00000217964	0.902	F-box-like/WD repeat-containing protein TBL1X
7	9606.ENSP00000405574	0.902	F-box-like/WD repeat-containing protein TBL1XR1
8	9606.ENSP00000419692	0.902	Retinoic acid receptor RXR-alpha
9	9606.ENSP00000417401	0.901	Helicase with zinc finger domain 2
10	9606.ENSP00000260129	0.900	Trimethylguanosine synthase
11	9606.ENSP00000262367	0.900	CREB-binding protein
12	9606.ENSP00000300651	0.900	Mediator of RNA polymerase II transcription subunit 1
13	9606.ENSP00000325690	0.900	Histone-arginine methyltransferase CARM1
14	9606.ENSP00000363929	0.900	Nuclear receptor coactivator 6
15	9606.ENSP00000385216	0.900	Nuclear receptor coactivator 1
16	9606.ENSP00000399968	0.900	Nuclear receptor coactivator 2
17	9606.ENSP00000324648	0.898	Cytochrome P450 2B6
18	9606.ENSP00000260682	0.890	Cytochrome P450 2C9
19	9606.ENSP00000222982	0.888	Cytochrome P450 3A5
20	9606.ENSP00000342007	0.884	Cytochrome P450 1A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015020	1.000	glucuronosyltransferase activity
GO:0042803	0.999	protein homodimerization activity
GO:0046982	0.998	protein heterodimerization activity
GO:0019899	0.997	enzyme binding
GO:0001972	0.997	retinoic acid binding
GO:0098772	0.988	molecular function regulator activity
GO:0030234	0.841	enzyme regulator activity
GO:0004857	0.716	enzyme inhibitor activity
GO:0097159	0.373	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0044281	0.990	small molecule metabolic process
GO:0044238	0.988	primary metabolic process
GO:0071466	0.986	cellular response to xenobiotic stimulus
GO:0006082	0.984	organic acid metabolic process
GO:0009812	0.982	flavonoid metabolic process
GO:0006805	0.982	xenobiotic metabolic process
GO:0032787	0.946	monocarboxylic acid metabolic process
GO:0016101	0.946	diterpenoid metabolic process
GO:0001523	0.939	retinoid metabolic process
GO:0065007	0.932	biological regulation
GO:0042573	0.899	retinoic acid metabolic process
GO:1901360	0.852	organic cyclic compound metabolic process
GO:0050794	0.789	regulation of cellular process
GO:0062014	0.745	negative regulation of small molecule metabolic process
GO:0019216	0.742	regulation of lipid metabolic process
GO:0010565	0.725	regulation of cellular ketone metabolic process
GO:0045833	0.697	negative regulation of lipid metabolic process
GO:0010677	0.693	negative regulation of cellular carbohydrate metabolic process
GO:0042440	0.646	pigment metabolic process
GO:0019217	0.574	regulation of fatty acid metabolic process
GO:0045922	0.536	negative regulation of fatty acid metabolic process
GO:0008202	0.520	steroid metabolic process
GO:0006807	0.395	nitrogen compound metabolic process
GO:0006725	0.320	cellular aromatic compound metabolic process
GO:0046483	0.305	heterocycle metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	0.998	endoplasmic reticulum
GO:0031090	0.863	organelle membrane
GO:0005789	0.823	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21032	1.000	glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
EC:2.4.1.17	1.000	glucuronosyltransferase.

[back to server]