StarFunc result for job id O60658

User Input

>input (829 residues)
MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSG
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQYA
NPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNI
QQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSL
DVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPIS
LDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRS
WLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
PGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQG
IIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRM
LIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQIS
FIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60658	1.000	1.000	0.000	829	1.000	1.000	O60658.pdb.gz	PDE8A_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Homo sapiens OX=9606 GN=PDE8A PE=1 SV=2
2	AFDB:O88502	0.500	0.503	4.670E-96	823	0.791	0.797	O88502.pdb.gz	PDE8A_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Mus musculus OX=10090 GN=Pde8a PE=1 SV=1
3	AFDB:E9Q4S1	0.773	0.743	4.630E-87	865	0.656	0.629	E9Q4S1.pdb.gz	PDE8B_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Mus musculus OX=10090 GN=Pde8b PE=1 SV=1
4	AFDB:O95263	0.746	0.702	6.656E-85	885	0.650	0.609	O95263.pdb.gz	PDE8B_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Homo sapiens OX=9606 GN=PDE8B PE=1 SV=2
5	AFDB:Q6NNF2	0.495	0.451	1.858E-57	914	0.369	0.335	Q6NNF2.pdb.gz	PDE8_DROME High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 OS=Drosophila melanogaster OX=7227 GN=Pde8 PE=2 SV=1
6	AFDB:Q9N2V9	0.477	0.517	9.588E-41	760	0.264	0.288	Q9N2V9.pdb.gz	PDE6_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-6 OS=Caenorhabditis elegans OX=6239 GN=pde-6 PE=3 SV=1
7	AFDB:Q23917	0.364	0.380	7.536E-24	793	0.177	0.185	Q23917.pdb.gz	PDE2_DICDI 3',5'-cyclic-nucleotide phosphodiesterase regA OS=Dictyostelium discoideum OX=44689 GN=regA PE=1 SV=1
8	AFDB:Q3UEI1	0.414	0.497	4.235E-23	686	0.174	0.210	Q3UEI1.pdb.gz	PDE4C_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Mus musculus OX=10090 GN=Pde4c PE=1 SV=1
9	AFDB:Q9W4S9	0.405	0.345	4.805E-23	983	0.171	0.144	Q9W4S9.pdb.gz	PDE4C_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoforms N/G OS=Drosophila melanogaster OX=7227 GN=dnc PE=3 SV=2
10	AFDB:Q9W4T4	0.406	0.283	6.186E-23	1209	0.170	0.117	Q9W4T4.pdb.gz	PDE4A_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=2
11	PDB:4y86B	0.359	0.889	2.597E-18	326	0.125	0.319	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
12	PDB:7jsnA	0.362	0.366	2.011E-15	820	0.139	0.140	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
13	PDB:6mzbB	0.367	0.377	7.112E-15	807	0.142	0.146	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
14	PDB:3bjcA	0.327	0.832	2.246E-13	311	0.090	0.241	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
15	PDB:3breB	0.125	0.303	2.713E-5	328	0.048	0.122	3breB.pdb.gz	Phosphorylation-independent regulation of the diguanylate cyclase WspR.
16	PDB:2wkpA	0.130	0.323	4.555E-4	320	0.025	0.066	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
17	PDB:2gwrA	0.130	0.437	1.150E-3	225	0.028	0.102	2gwrA.pdb.gz	Domain orientation in the inactive response regulator Mycobacterium tuberculosis MtrA provides a barrier to activation.
18	PDB:4knyB	0.117	0.389	1.680E-3	226	0.034	0.124	4knyB.pdb.gz	An asymmetric heterodomain interface stabilizes a response regulator-DNA complex.
19	PDB:6rgzD	0.133	0.796	3.160E-3	122	0.021	0.139	6rgzD.pdb.gz	Revisiting the pH-gated conformational switch on the activities of HisKA-family histidine kinases.
20	PDB:3a10A	0.125	0.753	4.425E-3	116	0.023	0.164	3a10A.pdb.gz	Structure of PAS-linked histidine kinase and the response regulator complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZT43	0.0	1102	769	0.627	0.676	A0A8I5ZT43_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde8b PE=3 SV=1
2	A0A8I5ZTX5	0.0	1135	885	0.668	0.626	A0A8I5ZTX5_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde8b PE=3 SV=1
3	A0A8I6AJW4	0.0	765	788	0.435	0.458	A0A8I6AJW4_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde8b PE=3 SV=1
4	A0A8I6AKA5	0.0	1050	838	0.632	0.625	A0A8I6AKA5_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde8b PE=3 SV=1
5	A0A8I6ALV2	0.0	1036	731	0.604	0.685	A0A8I6ALV2_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde8b PE=3 SV=1
6	A0A8I6AT14	0.0	1011	830	0.612	0.611	A0A8I6AT14_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde8b PE=3 SV=1
7	A0A8I6GB63	0.0	1114	865	0.659	0.631	A0A8I6GB63_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde8b PE=3 SV=1
8	E9Q4S1	0.0	1116	865	0.657	0.630	PDE8B_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Mus musculus OX=10090 GN=Pde8b PE=1 SV=1
9	F7ES56	0.0	1122	782	0.638	0.676	F7ES56_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde8b PE=3 SV=1
10	O60658	0.0	1736	829	1.000	1.000	PDE8A_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Homo sapiens OX=9606 GN=PDE8A PE=1 SV=2
11	O88502	0.0	1385	823	0.793	0.798	PDE8A_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Mus musculus OX=10090 GN=Pde8a PE=1 SV=1
12	O95263	0.0	1130	885	0.665	0.623	PDE8B_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Homo sapiens OX=9606 GN=PDE8B PE=1 SV=2
13	Q76KC5	0.0	1111	761	0.632	0.689	Q76KC5_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde8b PE=2 SV=1
14	Q6NNF2	7.87e-173	524	914	0.361	0.327	PDE8_DROME High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 OS=Drosophila melanogaster OX=7227 GN=Pde8 PE=2 SV=1
15	Q9N2V9	1.76e-85	290	760	0.207	0.226	PDE6_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-6 OS=Caenorhabditis elegans OX=6239 GN=pde-6 PE=3 SV=1
16	P14644	4.52e-64	226	536	0.140	0.216	PDE4C_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4C (Fragment) OS=Rattus norvegicus OX=10116 GN=Pde4c PE=2 SV=2
17	Q3UEI1	5.73e-64	229	686	0.141	0.171	PDE4C_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Mus musculus OX=10090 GN=Pde4c PE=1 SV=1
18	Q08493	1.02e-63	229	712	0.142	0.166	PDE4C_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Homo sapiens OX=9606 GN=PDE4C PE=1 SV=2
19	Q3TTI9	7.30e-63	221	484	0.144	0.246	Q3TTI9_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
20	G8JYF6	1.30e-62	226	697	0.172	0.205	G8JYF6_CAEEL Phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=pde-6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19246 DUF5894	1.5e+02	13.3	Family of unknown function (DUF5894)
2	PF13384 HTH_23	5.4e+02	11.9	Homeodomain-like domain
3	PF00989 PAS	7.4e-09	47.0	PAS fold
4	PF08447 PAS_3	0.17	23.5	PAS fold
5	PF08448 PAS_4	0.034	25.8	PAS fold
6	PF13188 PAS_8	38	15.7	PAS domain
7	PF13426 PAS_9	1.3e-07	43.2	PAS domain
8	PF08629 PDE8	11	17.6	PDE8 phosphodiesterase
9	PF00233 PDEase_I	6.5e-94	325.6	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311453

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286648	0.912	Deoxycytidine kinase
2	9606.ENSP00000286621	0.910	Adenosine kinase
3	9606.ENSP00000371230	0.903	GTP:AMP phosphotransferase AK3, mitochondrial
4	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
5	9606.ENSP00000485525	0.900	Adenylosuccinate lyase
6	9606.ENSP00000264917	0.804	High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
7	9606.ENSP00000438284	0.788	cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
8	9606.ENSP00000294016	0.761	Adenylate cyclase type 9
9	9606.ENSP00000286355	0.760	Adenylate cyclase type 8
10	9606.ENSP00000378187	0.759	Adenylate cyclase type 7
11	9606.ENSP00000356825	0.747	Adenylate cyclase type 10
12	9606.ENSP00000260600	0.737	Adenylate cyclase type 3
13	9606.ENSP00000419361	0.734	Adenylate cyclase type 5
14	9606.ENSP00000312126	0.732	Adenylate cyclase type 4
15	9606.ENSP00000256578	0.729	AMP deaminase 2
16	9606.ENSP00000297323	0.725	Adenylate cyclase type 1
17	9606.ENSP00000334910	0.719	cGMP-dependent 3',5'-cyclic phosphodiesterase
18	9606.ENSP00000311405	0.717	Adenylate cyclase type 6
19	9606.ENSP00000342952	0.716	Adenylate cyclase type 2
20	9606.ENSP00000379802	0.710	AMP deaminase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004115	1.000	3',5'-cyclic-AMP phosphodiesterase activity
GO:0005515	0.995	protein binding
GO:0047555	0.890	3',5'-cyclic-GMP phosphodiesterase activity
GO:0019899	0.569	enzyme binding
GO:0019900	0.554	kinase binding
GO:1901363	0.365	heterocyclic compound binding
GO:0097159	0.364	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0010646	0.969	regulation of cell communication
GO:0023051	0.968	regulation of signaling
GO:0070848	0.966	response to growth factor
GO:0048583	0.923	regulation of response to stimulus
GO:0070849	0.913	response to epidermal growth factor
GO:0009987	0.770	cellular process
GO:0048518	0.746	positive regulation of biological process
GO:0071364	0.744	cellular response to epidermal growth factor stimulus
GO:0009966	0.693	regulation of signal transduction
GO:0048523	0.692	negative regulation of cellular process
GO:1902531	0.682	regulation of intracellular signal transduction
GO:0048522	0.658	positive regulation of cellular process
GO:0009967	0.640	positive regulation of signal transduction
GO:0048585	0.625	negative regulation of response to stimulus
GO:0043410	0.475	positive regulation of MAPK cascade
GO:0070374	0.448	positive regulation of ERK1 and ERK2 cascade
GO:0051716	0.404	cellular response to stimulus
GO:1902882	0.398	regulation of response to oxidative stress
GO:0065008	0.390	regulation of biological quality
GO:0019222	0.340	regulation of metabolic process
GO:0071704	0.330	organic substance metabolic process
GO:0060255	0.318	regulation of macromolecule metabolic process
GO:1901031	0.308	regulation of response to reactive oxygen species
GO:0010817	0.305	regulation of hormone levels

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.999	membrane-bounded organelle
GO:0005576	0.985	extracellular region
GO:0031982	0.980	vesicle
GO:0005615	0.947	extracellular space
GO:0043230	0.928	extracellular organelle
GO:1903561	0.921	extracellular vesicle
GO:0043229	0.841	intracellular organelle
GO:0070062	0.827	extracellular exosome
GO:0043231	0.752	intracellular membrane-bounded organelle
GO:0016020	0.523	membrane
GO:0071944	0.447	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	1.000	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	1.000	3',5'-cyclic-AMP phosphodiesterase.
RHEA:16957	0.890	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.35	0.890	3',5'-cyclic-GMP phosphodiesterase.

[back to server]