StarFunc result for job id O60674

User Input

>input (1132 residues)
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0V237	0.905	0.928	0.000	1103	0.485	0.498	B0V237.pdb.gz	B0V237_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak3 PE=3 SV=1
2	AFDB:F1QWX8	0.657	0.678	0.000	1095	0.633	0.655	F1QWX8.pdb.gz	F1QWX8_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=3 SV=1
3	AFDB:G1TCI4	0.684	0.684	0.000	1132	0.954	0.954	G1TCI4.pdb.gz	G1TCI4_RABIT Tyrosine-protein kinase OS=Oryctolagus cuniculus OX=9986 GN=JAK2 PE=3 SV=2
4	AFDB:P23458	0.848	0.833	0.000	1154	0.438	0.430	P23458.pdb.gz	JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2
5	AFDB:P52333	0.896	0.902	0.000	1124	0.482	0.486	P52333.pdb.gz	JAK3_HUMAN Tyrosine-protein kinase JAK3 OS=Homo sapiens OX=9606 GN=JAK3 PE=1 SV=2
6	AFDB:Q62137	0.645	0.663	0.000	1100	0.475	0.489	Q62137.pdb.gz	JAK3_MOUSE Tyrosine-protein kinase JAK3 OS=Mus musculus OX=10090 GN=Jak3 PE=1 SV=2
7	AFDB:D3ZD03	0.835	0.800	6.486E-102	1186	0.398	0.379	D3ZD03.pdb.gz	D3ZD03_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tyk2 PE=1 SV=1
8	AFDB:O12990	0.639	0.628	1.899E-101	1153	0.422	0.415	O12990.pdb.gz	JAK1_DANRE Tyrosine-protein kinase JAK1 OS=Danio rerio OX=7955 GN=jak1 PE=1 SV=1
9	AFDB:S5R2L7	0.633	0.610	4.558E-100	1176	0.402	0.387	S5R2L7.pdb.gz	S5R2L7_SALSA Tyrosine-protein kinase OS=Salmo salar OX=8030 PE=2 SV=1
10	AFDB:P29597	0.609	0.582	3.850E-96	1187	0.393	0.375	P29597.pdb.gz	TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2 OS=Homo sapiens OX=9606 GN=TYK2 PE=1 SV=3
11	PDB:4fl2A	0.212	0.413	2.278E-20	555	0.126	0.258	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:4k2rA	0.220	0.431	5.979E-19	551	0.097	0.200	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:2h8hA	0.208	0.509	8.386E-18	445	0.093	0.236	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:1k9aB	0.218	0.543	1.003E-17	441	0.083	0.213	1k9aB.pdb.gz
15	PDB:8dksA	0.188	0.693	1.814E-13	283	0.061	0.244	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:4eomC	0.203	0.769	4.440E-13	276	0.057	0.232	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	PDB:2qkwB	0.207	0.729	5.078E-13	292	0.067	0.260	2qkwB.pdb.gz
18	PDB:4krcA	0.190	0.655	5.808E-13	297	0.057	0.219	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:6s73A	0.202	0.789	6.351E-13	269	0.057	0.242	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
20	PDB:2bujA	0.206	0.743	7.945E-13	291	0.050	0.196	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GTR9	1488	710	0.627	1.000	A0A1B0GTR9_HUMAN Tyrosine-protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=JAK2 PE=1 SV=1
2	A0A8I5ZU24	893	1140	0.438	0.435	A0A8I5ZU24_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
3	A0A8I6AJU1	860	1120	0.421	0.426	A0A8I6AJU1_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
4	A0A8I6AM23	910	1153	0.443	0.435	A0A8I6AM23_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
5	B0V237	1114	1103	0.487	0.500	B0V237_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak3 PE=3 SV=1
6	D3ZD03	769	1186	0.410	0.391	D3ZD03_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tyk2 PE=1 SV=1
7	F1QWX8	1527	1095	0.638	0.659	F1QWX8_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=3 SV=1
8	G1TCI4	2244	1132	0.954	0.954	G1TCI4_RABIT Tyrosine-protein kinase OS=Oryctolagus cuniculus OX=9986 GN=JAK2 PE=3 SV=2
9	G3V9W2	910	1153	0.443	0.435	G3V9W2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=3 SV=1
10	K7GSE8	1080	1103	0.487	0.500	K7GSE8_PIG Tyrosine-protein kinase OS=Sus scrofa OX=9823 GN=JAK3 PE=3 SV=1
11	O12990	861	1153	0.420	0.413	JAK1_DANRE Tyrosine-protein kinase JAK1 OS=Danio rerio OX=7955 GN=jak1 PE=1 SV=1
12	O35803	642	866	0.328	0.428	O35803_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 GN=Jak1 PE=2 SV=1
13	O60674	2375	1132	1.000	1.000	JAK2_HUMAN Tyrosine-protein kinase JAK2 OS=Homo sapiens OX=9606 GN=JAK2 PE=1 SV=2
14	O93596	1529	1095	0.639	0.660	O93596_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=2 SV=1
15	P23458	916	1154	0.444	0.436	JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2
16	P29597	780	1187	0.398	0.380	TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2 OS=Homo sapiens OX=9606 GN=TYK2 PE=1 SV=3
17	P52332	912	1153	0.441	0.433	JAK1_MOUSE Tyrosine-protein kinase JAK1 OS=Mus musculus OX=10090 GN=Jak1 PE=1 SV=1
18	P52333	1071	1124	0.484	0.488	JAK3_HUMAN Tyrosine-protein kinase JAK3 OS=Homo sapiens OX=9606 GN=JAK3 PE=1 SV=2
19	Q62120	2221	1132	0.937	0.937	JAK2_MOUSE Tyrosine-protein kinase JAK2 OS=Mus musculus OX=10090 GN=Jak2 PE=1 SV=3
20	Q62137	1060	1100	0.471	0.485	JAK3_MOUSE Tyrosine-protein kinase JAK3 OS=Mus musculus OX=10090 GN=Jak3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1	20.0	ABC1 atypical kinase-like domain
2	PF01636 APH	2.4e+02	12.9	Phosphotransferase enzyme family
3	PF18379 FERM_F1	1.1e-37	139.3	FERM F1 ubiquitin-like domain
4	PF18377 FERM_F2	1.7e-41	152.6	FERM F2 acyl-CoA binding protein-like domain
5	PF17887 Jak1_Phl	1.3e-18	78.7	Jak1 pleckstrin homology-like domain
6	PF06293 Kdo	0.61	21.0	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	8.4	17.2	Kinase-like
8	PF00069 Pkinase	7.9e-71	250.1	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	1.1e-145	495.3	Protein tyrosine and serine/threonine kinase
10	PF01163 RIO1	12	17.0	RIO1 family
11	PF00017 SH2	0.0025	29.2	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371067

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222139	0.999	Erythropoietin receptor
2	9606.ENSP00000264657	0.999	Signal transducer and activator of transcription 3
3	9606.ENSP00000293328	0.999	Signal transducer and activator of transcription 5B
4	9606.ENSP00000304895	0.999	Insulin receptor substrate 1
5	9606.ENSP00000329418	0.999	Suppressor of cytokine signaling 1
6	9606.ENSP00000330341	0.999	Suppressor of cytokine signaling 3
7	9606.ENSP00000330393	0.999	Leptin receptor
8	9606.ENSP00000340944	0.999	Tyrosine-protein phosphatase non-receptor type 11
9	9606.ENSP00000341208	0.999	Signal transducer and activator of transcription 5A
10	9606.ENSP00000354394	0.999	Signal transducer and activator of transcription 1-alpha/beta
11	9606.ENSP00000356713	0.999	Interferon gamma receptor 1
12	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
13	9606.ENSP00000482954	0.999	Prolactin receptor
14	9606.ENSP00000483403	0.999	Growth hormone receptor
15	9606.ENSP00000290219	0.998	Interferon gamma receptor 2
16	9606.ENSP00000321221	0.998	SH2B adapter protein 1
17	9606.ENSP00000361548	0.998	Thrombopoietin receptor
18	9606.ENSP00000360683	0.997	Tyrosine-protein phosphatase non-receptor type 1
19	9606.ENSP00000319169	0.996	Protein arginine N-methyltransferase 5
20	9606.ENSP00000321345	0.996	Interleukin-23 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004715	1.000	non-membrane spanning protein tyrosine kinase activity
GO:0005126	0.999	cytokine receptor binding
GO:0019899	0.709	enzyme binding
GO:0005131	0.414	growth hormone receptor binding
GO:0019902	0.408	phosphatase binding
GO:0001664	0.304	G protein-coupled receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.986	positive regulation of biological process
GO:0007165	0.985	signal transduction
GO:0007166	0.984	cell surface receptor signaling pathway
GO:0048522	0.979	positive regulation of cellular process
GO:0008152	0.976	metabolic process
GO:0048583	0.975	regulation of response to stimulus
GO:0018212	0.974	peptidyl-tyrosine modification
GO:0044237	0.971	cellular metabolic process
GO:0023051	0.967	regulation of signaling
GO:0034097	0.966	response to cytokine
GO:0010646	0.965	regulation of cell communication
GO:0071310	0.964	cellular response to organic substance
GO:0009966	0.963	regulation of signal transduction
GO:0048584	0.962	positive regulation of response to stimulus
GO:0007259	0.960	receptor signaling pathway via JAK-STAT
GO:0018108	0.959	peptidyl-tyrosine phosphorylation
GO:0022409	0.957	positive regulation of cell-cell adhesion
GO:0050870	0.948	positive regulation of T cell activation
GO:0019221	0.947	cytokine-mediated signaling pathway
GO:0009967	0.945	positive regulation of signal transduction
GO:0032501	0.941	multicellular organismal process
GO:0032502	0.928	developmental process
GO:0001819	0.927	positive regulation of cytokine production
GO:0042102	0.926	positive regulation of T cell proliferation
GO:0002376	0.912	immune system process
GO:0048856	0.910	anatomical structure development
GO:0007167	0.903	enzyme-linked receptor protein signaling pathway
GO:1904894	0.886	positive regulation of receptor signaling pathway via STAT
GO:0046427	0.869	positive regulation of receptor signaling pathway via JAK-STAT
GO:0006955	0.850	immune response
GO:0048869	0.833	cellular developmental process
GO:0048519	0.825	negative regulation of biological process
GO:0030154	0.823	cell differentiation
GO:0031323	0.821	regulation of cellular metabolic process
GO:1901701	0.804	cellular response to oxygen-containing compound
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:1901698	0.793	response to nitrogen compound
GO:1902533	0.789	positive regulation of intracellular signal transduction
GO:0080090	0.780	regulation of primary metabolic process
GO:0048468	0.769	cell development
GO:0006950	0.768	response to stress
GO:0035556	0.759	intracellular signal transduction
GO:0009719	0.757	response to endogenous stimulus
GO:0010243	0.757	response to organonitrogen compound
GO:0006952	0.704	defense response
GO:0048523	0.703	negative regulation of cellular process
GO:0009605	0.693	response to external stimulus
GO:0031325	0.668	positive regulation of cellular metabolic process
GO:0051707	0.647	response to other organism
GO:0140888	0.642	interferon-mediated signaling pathway
GO:0098542	0.551	defense response to other organism
GO:0045321	0.549	leukocyte activation
GO:0051173	0.547	positive regulation of nitrogen compound metabolic process
GO:0007275	0.545	multicellular organism development
GO:0019219	0.500	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.486	regulation of cellular biosynthetic process
GO:0010556	0.476	regulation of macromolecule biosynthetic process
GO:0051246	0.449	regulation of protein metabolic process
GO:0065009	0.445	regulation of molecular function
GO:0051247	0.427	positive regulation of protein metabolic process
GO:0080134	0.410	regulation of response to stress
GO:0031399	0.401	regulation of protein modification process
GO:0071495	0.392	cellular response to endogenous stimulus
GO:0051252	0.380	regulation of RNA metabolic process
GO:0010941	0.371	regulation of cell death
GO:0042325	0.342	regulation of phosphorylation
GO:0006355	0.318	regulation of DNA-templated transcription
GO:0043067	0.317	regulation of programmed cell death
GO:0001934	0.317	positive regulation of protein phosphorylation
GO:0044093	0.311	positive regulation of molecular function
GO:0050793	0.309	regulation of developmental process
GO:0034341	0.309	response to type II interferon
GO:0042981	0.308	regulation of apoptotic process
GO:0050790	0.300	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.998	nucleus
GO:0071944	0.985	cell periphery
GO:0005886	0.978	plasma membrane
GO:0005829	0.974	cytosol
GO:0070013	0.942	intracellular organelle lumen
GO:0031981	0.933	nuclear lumen
GO:0005654	0.650	nucleoplasm
GO:0030054	0.649	cell junction
GO:0012505	0.402	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.2	1.000	non-specific protein-tyrosine kinase.

[back to server]