StarFunc result for job id O60675

User Input

>input (156 residues)
MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLK
NRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFART
VARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R804	0.865	0.865	1.939E-19	156	1.000	1.000	A0A024R804.pdb.gz
2	AFDB:A0A0R4IVU1	0.800	0.795	7.090E-16	157	0.827	0.822	A0A0R4IVU1.pdb.gz	A0A0R4IVU1_DANRE Transcription factor MafK isoform X1 OS=Danio rerio OX=7955 GN=mafk PE=4 SV=1
3	AFDB:Q6NW89	0.724	0.664	1.226E-14	171	0.731	0.667	Q6NW89.pdb.gz	Q6NW89_DANRE Transcription factor mafG2 OS=Danio rerio OX=7955 GN=mafg2 PE=2 SV=1
4	AFDB:Q76MX4	0.691	0.579	3.966E-13	189	0.686	0.566	Q76MX4.pdb.gz	MAFG_RAT Transcription factor MafG OS=Rattus norvegicus OX=10116 GN=Mafg PE=2 SV=2
5	AFDB:Q9ULX9	0.667	0.635	1.580E-11	164	0.603	0.573	Q9ULX9.pdb.gz	MAFF_HUMAN Transcription factor MafF OS=Homo sapiens OX=9606 GN=MAFF PE=1 SV=2
6	AFDB:Q7T3H0	0.674	0.666	6.805E-11	158	0.596	0.589	Q7T3H0.pdb.gz	Q7T3H0_DANRE Transcription factor MafF OS=Danio rerio OX=7955 GN=maft PE=2 SV=1
7	AFDB:F6WVZ0	0.653	0.634	1.089E-8	161	0.391	0.379	F6WVZ0.pdb.gz	F6WVZ0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=LOC778757 PE=1 SV=1
8	AFDB:A3KMR8	0.634	0.325	5.390E-8	315	0.391	0.194	A3KMR8.pdb.gz	MAFA_DANRE Transcription factor MafAa OS=Danio rerio OX=7955 GN=mafaa PE=2 SV=1
9	AFDB:P54841	0.653	0.327	6.640E-8	323	0.442	0.214	P54841.pdb.gz	MAFB_MOUSE Transcription factor MafB OS=Mus musculus OX=10090 GN=Mafb PE=1 SV=1
10	AFDB:D3ZNT6	0.586	0.257	1.639E-7	361	0.385	0.166	D3ZNT6.pdb.gz	MAFA_RAT Transcription factor MafA OS=Rattus norvegicus OX=10116 GN=Mafa PE=1 SV=1
11	PDB:6yxxBS	0.299	0.291	1.855	161	0.147	0.143	6yxxBS.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
12	PDB:7nvmP	0.203	0.172	2.285	190	0.071	0.058	7nvmP.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
13	PDB:3j6bT	0.157	0.130	2.815	209	0.109	0.081	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
14	PDB:7f75D	0.131	0.026	3.468	1142	0.051	0.007	7f75D.pdb.gz	Structural basis of transcription activation by the global regulator Spx.
15	PDB:7v2wI	0.272	0.193	3.468	240	0.128	0.083	7v2wI.pdb.gz
16	PDB:5svaU	0.212	0.212	3.718	156	0.090	0.090	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:7rdqD	0.163	0.023	3.718	1366	0.032	0.004	7rdqD.pdb.gz	Structural and mechanistic basis of reiterative transcription initiation.
18	PDB:7r6k7	0.218	0.295	4.273	109	0.064	0.092	7r6k7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
19	PDB:2uwjE	0.147	0.295	4.580	70	0.058	0.129	2uwjE.pdb.gz
20	PDB:7aocD	0.152	0.451	4.910	39	0.038	0.154	7aocD.pdb.gz	Conserved strategies of RNA polymerase I hibernation and activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60675	2.92e-110	311	156	1.000	1.000	MAFK_HUMAN Transcription factor MafK OS=Homo sapiens OX=9606 GN=MAFK PE=1 SV=1
2	Q61827	3.00e-108	306	156	0.981	0.981	MAFK_MOUSE Transcription factor MafK OS=Mus musculus OX=10090 GN=Mafk PE=1 SV=1
3	Q6IRI7	1.79e-107	305	156	0.974	0.974	Q6IRI7_RAT V-maf musculoaponeurotic fibrosarcoma oncogene homolog K (Avian) OS=Rattus norvegicus OX=10116 GN=Mafk PE=1 SV=1
4	Q4V999	6.19e-89	258	154	0.833	0.844	Q4V999_DANRE Transcription factor MafK OS=Danio rerio OX=7955 GN=mafk PE=2 SV=1
5	A0A0R4IVU1	3.87e-88	256	157	0.827	0.822	A0A0R4IVU1_DANRE Transcription factor MafK isoform X1 OS=Danio rerio OX=7955 GN=mafk PE=4 SV=1
6	Q6I6N2	1.30e-76	227	162	0.744	0.716	Q6I6N2_DANRE Transcription factor MafG OS=Danio rerio OX=7955 GN=mafg1 PE=2 SV=1
7	O15525	2.72e-76	226	162	0.750	0.722	MAFG_HUMAN Transcription factor MafG OS=Homo sapiens OX=9606 GN=MAFG PE=1 SV=1
8	Q6NW89	1.06e-75	225	171	0.750	0.684	Q6NW89_DANRE Transcription factor mafG2 OS=Danio rerio OX=7955 GN=mafg2 PE=2 SV=1
9	O54790	2.04e-75	224	162	0.744	0.716	MAFG_MOUSE Transcription factor MafG OS=Mus musculus OX=10090 GN=Mafg PE=1 SV=1
10	Q76MX4	2.10e-70	212	189	0.692	0.571	MAFG_RAT Transcription factor MafG OS=Rattus norvegicus OX=10116 GN=Mafg PE=2 SV=2
11	Q9ULX9	3.18e-65	198	164	0.654	0.622	MAFF_HUMAN Transcription factor MafF OS=Homo sapiens OX=9606 GN=MAFF PE=1 SV=2
12	O54791	1.35e-63	194	156	0.647	0.647	MAFF_MOUSE Transcription factor MafF OS=Mus musculus OX=10090 GN=Maff PE=2 SV=1
13	B0QY70	5.57e-59	181	125	0.558	0.696	B0QY70_HUMAN MAF bZIP transcription factor F (Fragment) OS=Homo sapiens OX=9606 GN=MAFF PE=1 SV=8
14	Q7T3H0	3.46e-57	177	158	0.596	0.589	Q7T3H0_DANRE Transcription factor MafF OS=Danio rerio OX=7955 GN=maft PE=2 SV=1
15	F6WVZ0	3.38e-40	134	161	0.397	0.385	F6WVZ0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=LOC778757 PE=1 SV=1
16	P54841	6.14e-32	117	323	0.423	0.204	MAFB_MOUSE Transcription factor MafB OS=Mus musculus OX=10090 GN=Mafb PE=1 SV=1
17	Q9Y5Q3	2.25e-31	116	323	0.372	0.180	MAFB_HUMAN Transcription factor MafB OS=Homo sapiens OX=9606 GN=MAFB PE=1 SV=2
18	P54842	3.23e-31	115	323	0.372	0.180	MAFB_RAT Transcription factor MafB OS=Rattus norvegicus OX=10116 GN=Mafb PE=1 SV=1
19	Q4QPP9	1.45e-30	109	132	0.346	0.409	Q4QPP9_DROME GH02096p OS=Drosophila melanogaster OX=7227 GN=maf-S PE=2 SV=1
20	A0A0B4LH09	1.73e-30	109	137	0.346	0.394	A0A0B4LH09_DROME Maf-S, isoform B OS=Drosophila melanogaster OX=7227 GN=maf-S PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.43	22.0	bZIP transcription factor
2	PF07716 bZIP_2	4.6e+02	12.3	Basic region leucine zipper
3	PF03131 bZIP_Maf	5.2e-31	118.4	bZIP Maf transcription factor
4	PF07989 Cnn_1N	6.2	18.4	Centrosomin N-terminal motif 1
5	PF08287 DASH_Spc19	5.6e+02	11.8	Spc19
6	PF04977 DivIC	1.3	20.2	Septum formation initiator
7	PF06698 DUF1192	21	16.6	Protein of unknown function (DUF1192)
8	PF19717 DUF6212	2.6e+02	12.0	Family of unknown function (DUF6212)
9	PF03961 FapA	1.3e+02	13.6	Flagellar Assembly Protein A beta solenoid domain
10	PF14932 HAUS-augmin3	2.2e+02	12.7	HAUS augmin-like complex subunit 3
11	PF13675 PilJ	2.3e+02	13.3	Type IV pili methyl-accepting chemotaxis transducer N-term
12	PF05478 Prominin	3.1e+02	10.8	Prominin
13	PF08286 Spc24	32	16.2	Spc24 subunit of Ndc80
14	PF01166 TSC22	5.9e+02	12.1	TSC-22/dip/bun family
15	PF06156 YabA	6.5e+02	12.4	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344903

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380252	0.998	Nuclear factor erythroid 2-related factor 2
2	9606.ENSP00000257749	0.978	Transcription regulator protein BACH2
3	9606.ENSP00000439120	0.978	Transcription factor NF-E2 45 kDa subunit
4	9606.ENSP00000382805	0.927	Transcription regulator protein BACH1
5	9606.ENSP00000056233	0.926	Nuclear factor erythroid 2-related factor 3
6	9606.ENSP00000354855	0.919	Nuclear factor erythroid 2-related factor 1
7	9606.ENSP00000302967	0.915	Histone deacetylase 3
8	9606.ENSP00000369586	0.913	Hemoglobin subunit epsilon
9	9606.ENSP00000345393	0.910	Transcription factor MafF
10	9606.ENSP00000350369	0.907	Transcription factor MafG
11	9606.ENSP00000327431	0.900	Hemoglobin subunit gamma 1
12	9606.ENSP00000333994	0.900	Hemoglobin subunit beta
13	9606.ENSP00000369609	0.900	Hemoglobin subunit gamma-2
14	9606.ENSP00000369654	0.900	Hemoglobin subunit delta
15	9606.ENSP00000171111	0.841	Kelch-like ECH-associated protein 1
16	9606.ENSP00000222305	0.778	Upstream stimulatory factor 2
17	9606.ENSP00000331298	0.727	UBA-like domain-containing protein 2
18	9606.ENSP00000363616	0.670	ER degradation-enhancing alpha-mannosidase-like protein 2
19	9606.ENSP00000438468	0.648	Protein-cysteine N-palmitoyltransferase HHAT
20	9606.ENSP00000216117	0.644	Heme oxygenase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0001067	0.999	transcription regulatory region nucleic acid binding
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0000976	0.991	transcription cis-regulatory region binding
GO:0046983	0.903	protein dimerization activity
GO:0046982	0.888	protein heterodimerization activity
GO:0000981	0.694	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.996	regulation of metabolic process
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0048518	0.580	positive regulation of biological process
GO:0048522	0.551	positive regulation of cellular process
GO:0009893	0.530	positive regulation of metabolic process
GO:0009987	0.527	cellular process
GO:0010604	0.515	positive regulation of macromolecule metabolic process
GO:0051173	0.504	positive regulation of nitrogen compound metabolic process
GO:0031325	0.504	positive regulation of cellular metabolic process
GO:0006357	0.496	regulation of transcription by RNA polymerase II
GO:0045893	0.463	positive regulation of DNA-templated transcription
GO:0048519	0.461	negative regulation of biological process
GO:0051172	0.359	negative regulation of nitrogen compound metabolic process
GO:0048523	0.352	negative regulation of cellular process
GO:0010605	0.338	negative regulation of macromolecule metabolic process
GO:0031324	0.306	negative regulation of cellular metabolic process
GO:1903507	0.300	negative regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.968	protein-containing complex
GO:0005737	0.678	cytoplasm
GO:0005667	0.374	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]