StarFunc result for job id O60684

User Input

>input (536 residues)
METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEA
AMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVI
NTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDF
EDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRG
KNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLV
ELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTI
SNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSL
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIE
FLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35345	0.839	0.839	5.739E-61	536	0.993	0.993	O35345.pdb.gz	IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus OX=10090 GN=Kpna6 PE=1 SV=2
2	AFDB:O15131	0.865	0.865	1.119E-56	536	0.843	0.843	O15131.pdb.gz	IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens OX=9606 GN=KPNA5 PE=1 SV=3
3	AFDB:P52294	0.889	0.885	1.160E-54	538	0.813	0.810	P52294.pdb.gz	IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens OX=9606 GN=KPNA1 PE=1 SV=3
4	AFDB:O76521	0.896	0.885	9.730E-45	543	0.629	0.621	O76521.pdb.gz	O76521_DROME Importin subunit alpha OS=Drosophila melanogaster OX=7227 GN=Kap-alpha1 PE=2 SV=1
5	AFDB:G5EB89	0.863	0.837	7.912E-40	553	0.576	0.559	G5EB89.pdb.gz	KAPA_EMENI Importin subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=kapA PE=1 SV=1
6	AFDB:O04294	0.836	0.843	5.105E-39	531	0.532	0.537	O04294.pdb.gz	IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana OX=3702 GN=IMPA3 PE=1 SV=2
7	AFDB:O14063	0.786	0.777	7.012E-39	542	0.528	0.522	O14063.pdb.gz	IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut15 PE=1 SV=1
8	AFDB:O80480	0.814	0.811	2.495E-38	538	0.541	0.539	O80480.pdb.gz	IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis thaliana OX=3702 GN=IMPA4 PE=1 SV=1
9	AFDB:Q96321	0.824	0.830	2.702E-38	532	0.541	0.545	Q96321.pdb.gz	IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=IMPA1 PE=1 SV=2
10	AFDB:F4JL11	0.809	0.810	3.861E-38	535	0.532	0.533	F4JL11.pdb.gz	IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana OX=3702 GN=IMPA2 PE=1 SV=1
11	PDB:1wa5B	0.761	0.872	1.867E-36	466	0.463	0.532	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
12	PDB:4tnmA	0.728	0.955	4.259E-31	407	0.450	0.592	4tnmA.pdb.gz
13	PDB:5tbkA	0.725	0.921	2.082E-30	417	0.401	0.516	5tbkA.pdb.gz
14	PDB:3tpoA	0.743	0.904	3.487E-30	438	0.394	0.482	3tpoA.pdb.gz
15	PDB:2z6gA	0.503	0.493	1.937E-11	550	0.144	0.140	2z6gA.pdb.gz
16	PDB:6kbnC	0.584	0.617	2.991E-10	504	0.153	0.163	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
17	PDB:7rroH7	0.547	0.511	3.369E-10	580	0.136	0.126	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:4r0zA	0.597	0.577	4.440E-9	557	0.131	0.126	4r0zA.pdb.gz
19	PDB:7nscE	0.402	0.363	8.715E-9	615	0.136	0.119	7nscE.pdb.gz
20	PDB:4jlqA	0.430	0.301	1.457E-7	840	0.125	0.080	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F4JL11	0.0	521	535	0.539	0.540	IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana OX=3702 GN=IMPA2 PE=1 SV=1
2	G5EB89	0.0	585	553	0.578	0.561	KAPA_EMENI Importin subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=kapA PE=1 SV=1
3	O14063	0.0	544	542	0.515	0.509	IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut15 PE=1 SV=1
4	O15131	0.0	884	539	0.845	0.840	IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens OX=9606 GN=KPNA5 PE=1 SV=3
5	O35345	0.0	1097	536	0.993	0.993	IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus OX=10090 GN=Kpna6 PE=1 SV=2
6	O60684	0.0	1106	536	1.000	1.000	IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1
7	O76521	0.0	662	543	0.627	0.619	O76521_DROME Importin subunit alpha OS=Drosophila melanogaster OX=7227 GN=Kap-alpha1 PE=2 SV=1
8	O80480	0.0	543	538	0.539	0.537	IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis thaliana OX=3702 GN=IMPA4 PE=1 SV=1
9	O94374	0.0	536	539	0.515	0.512	IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp1 PE=1 SV=1
10	P52294	0.0	853	538	0.813	0.810	IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens OX=9606 GN=KPNA1 PE=1 SV=3
11	P83953	0.0	849	538	0.810	0.807	IMA5_RAT Importin subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Kpna1 PE=1 SV=1
12	Q02821	0.0	532	542	0.511	0.506	IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRP1 PE=1 SV=1
13	Q60960	0.0	850	538	0.810	0.807	IMA5_MOUSE Importin subunit alpha-5 OS=Mus musculus OX=10090 GN=Kpna1 PE=1 SV=2
14	Q96321	0.0	550	532	0.541	0.545	IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=IMPA1 PE=1 SV=2
15	Q9U1H6	0.0	647	542	0.618	0.611	Q9U1H6_DROME Importin subunit alpha OS=Drosophila melanogaster OX=7227 GN=Kap-alpha1 PE=3 SV=1
16	O04294	1.39e-179	518	531	0.513	0.518	IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana OX=3702 GN=IMPA3 PE=1 SV=2
17	Q9FWY7	3.86e-179	516	538	0.513	0.511	IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana OX=3702 GN=IMPA6 PE=1 SV=1
18	F4HXL3	2.94e-177	512	539	0.513	0.510	F4HXL3_ARATH Importin subunit alpha OS=Arabidopsis thaliana OX=3702 GN=IMPA-6 PE=1 SV=1
19	C9JYI4	9.19e-170	484	328	0.465	0.759	C9JYI4_HUMAN Karyopherin subunit alpha 1 (Fragment) OS=Homo sapiens OX=9606 GN=KPNA1 PE=1 SV=1
20	O00629	4.05e-169	490	521	0.472	0.486	IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	4.5e-86	291.8	Armadillo/beta-catenin-like repeat
2	PF04826 Arm_2	0.14	23.2	Armadillo-like
3	PF16186 Arm_3	1.2e-19	80.9	Atypical Arm repeat
4	PF08216 CTNNBL	2.1	18.3	Catenin-beta-like, Arm-motif containing nuclear
5	PF02985 HEAT	1.3e-09	48.4	HEAT repeat
6	PF13646 HEAT_2	2.7e-17	74.3	HEAT repeats
7	PF13513 HEAT_EZ	2.1e-19	81.0	HEAT-like repeat
8	PF03130 HEAT_PBS	2.8	19.8	PBS lyase HEAT-like repeat
9	PF01749 IBB	7.7e-21	85.7	Importin beta binding domain
10	PF16201 NopRA1	95	14.0	Nucleolar pre-ribosomal-associated protein 1
11	PF14668 RICTOR_V	0.7	21.5	Rapamycin-insensitive companion of mTOR, domain 5
12	PF12726 SEN1_N	68	13.2	SEN1 N terminal
13	PF11698 V-ATPase_H_C	0.041	25.4	V-ATPase subunit H

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010352195.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010377662.1	0.924	Karyopherin subunit beta 1
2	61622.XP_010378644.1	0.880	Regulator of chromosome condensation isoform X1
3	61622.XP_010351026.1	0.839	Nucleoporin 153
4	61622.XP_010353289.1	0.826	RAN, member RAS oncogene family
5	61622.XP_010369310.1	0.804	Cyclin dependent kinase inhibitor 1B
6	61622.XP_010382167.1	0.782	Chromosome segregation 1 like
7	61622.XP_010367070.1	0.771	RAN binding protein 2
8	61622.XP_010366555.1	0.759	Nucleoporin 50
9	61622.XP_010386739.1	0.737	Ran-specific GTPase-activating protein
10	61622.XP_010352458.1	0.712	SUMO1/sentrin specific peptidase 1
11	61622.XP_010377926.1	0.710	Tumor suppressor. Acts as a dual-specificity protein phosphatase, dephosphorylating tyrosine-, serine- and threonine- phosphorylated proteins. Also acts as a lipid phosphatase.
12	61622.XP_010353377.1	0.705	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 197 ESTs, 5 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
13	61622.XP_010374128.1	0.705	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 143 ESTs, 6 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
14	61622.XP_010374892.1	0.698	Ran GTPase-activating protein 1 isoform X1
15	61622.XP_010372297.1	0.693	General receptor for phosphoinositides 1 associated scaffold protein
16	61622.XP_010366974.1	0.669	GRIP and coiled-coil domain containing 2
17	61622.XP_010359259.1	0.666	Nucleoporin 214
18	61622.XP_010351088.1	0.663	TPX2, microtubule nucleation factor
19	61622.XP_010385416.1	0.658	Importin-5
20	61622.XP_010378063.1	0.656	Signal transducer and activator of transcription 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140142	0.459	nucleocytoplasmic carrier activity
GO:0061608	0.345	nuclear import signal receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0033365	0.977	protein localization to organelle
GO:0051234	0.975	establishment of localization
GO:0006913	0.973	nucleocytoplasmic transport
GO:0071705	0.971	nitrogen compound transport
GO:0051170	0.933	import into nucleus
GO:0034504	0.931	protein localization to nucleus
GO:0072594	0.931	establishment of protein localization to organelle
GO:0006886	0.930	intracellular protein transport
GO:0006606	0.916	protein import into nucleus
GO:0065007	0.876	biological regulation
GO:0050789	0.850	regulation of biological process
GO:0008152	0.664	metabolic process
GO:0050794	0.656	regulation of cellular process
GO:0071704	0.640	organic substance metabolic process
GO:0044238	0.454	primary metabolic process
GO:0006807	0.444	nitrogen compound metabolic process
GO:0044237	0.441	cellular metabolic process
GO:0043170	0.437	macromolecule metabolic process
GO:0048518	0.420	positive regulation of biological process
GO:0019222	0.372	regulation of metabolic process
GO:0060255	0.349	regulation of macromolecule metabolic process
GO:0051171	0.347	regulation of nitrogen compound metabolic process
GO:0080090	0.345	regulation of primary metabolic process
GO:0050896	0.343	response to stimulus
GO:0031323	0.333	regulation of cellular metabolic process
GO:0034641	0.319	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:0032991	0.988	protein-containing complex
GO:0016020	0.974	membrane
GO:0043232	0.944	intracellular non-membrane-bounded organelle
GO:0012505	0.585	endomembrane system
GO:0031074	0.471	nucleocytoplasmic transport complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]