StarFunc result for job id O60706

User Input

>input (1549 residues)
MSLSFCGNNISSYNINDGVLQNSCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHH
NTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSRRESRHLHLFMPAVMGFVATTTSIV
YYHNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGLDISNLRFCITGMMVILNGLL
MAVEINVIRVRRYVFFMNPQKVKPPEDLQDLGVRFLQPFVNLLSKATYWWMNTLIISAHK
KPIDLKAIGKLPIAMRAVTNYVCLKDAYEEQKKKVADHPNRTPSIWLAMYRAFGRPILLS
STFRYLADLLGFAGPLCISGIVQRVNETQNGTNNTTGISETLSSKEFLENAYVLAVLLFL
ALILQRTFLQASYYVTIETGINLRGALLAMIYNKILRLSTSNLSMGEMTLGQINNLVAIE
TNQLMWFLFLCPNLWAMPVQIIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEA
QKSTLDYSTERLKKTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSI
FMNAAIPIAAVLATFVTHAYASGNNLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAII
SVQKLNEFLLSDEIGDDSWRTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTR
RLRPAETEDIAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILG
EMQTLEGKVHWSNVNESEPSFEATRSRNRYSVAYAAQKPWLLNATVEENITFGSPFNKQR
YKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFS
ALDIHLSDHLMQEGILKFLQDDKRTLVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQ
TKDVELYEHWKTLMNRQDQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEE
EDEDDNMSTVMRLRTKMPWKTCWRYLTSGGFFLLILMIFSKLLKHSVIVAIDYWLATWTS
EYSINNTGKADQTYYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGP
IRFFDTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALL
PLGVAFYFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLE
LTDTNNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSNSGLVGLGLLYALTITN
YLNWVVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQVPEHWPQEGEIKIHDLCVR
YENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKL
PLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDA
VVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTV
VTIAHRVSSIMDAGLVLVFSEGILVECDTVPNLLAHKNGLFSTLVMTNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5wuaE	0.803	0.943	0.000	1312	0.611	0.721	5wuaE.pdb.gz
2	PDB:5ykfB	0.810	0.954	0.000	1309	0.622	0.736	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
3	PDB:6c3oE	0.641	0.759	0.000	1290	0.600	0.721	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
4	PDB:6c3pE	0.789	0.891	0.000	1359	0.640	0.729	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
5	PDB:6jb1B	0.844	0.955	0.000	1366	0.636	0.721	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
6	PDB:7mitE	0.892	0.959	0.000	1438	0.887	0.955	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
7	PDB:7s5xE	0.813	0.886	0.000	1412	0.658	0.722	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
8	PDB:7vluA	0.672	0.880	0.000	1159	0.734	0.981	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
9	AFDB:A0A0R4IC81	0.776	0.791	0.000	1518	0.313	0.319	A0A0R4IC81.pdb.gz	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
10	AFDB:B2RUS7	0.956	0.933	0.000	1588	0.680	0.664	B2RUS7.pdb.gz	B2RUS7_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
11	AFDB:B2RX12	0.739	0.751	0.000	1523	0.314	0.319	B2RX12.pdb.gz	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
12	AFDB:G5EFP3	0.746	0.736	0.000	1573	0.298	0.293	G5EFP3.pdb.gz	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
13	AFDB:O15438	0.773	0.784	0.000	1527	0.308	0.312	O15438.pdb.gz	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
14	AFDB:O60706	1.000	1.000	0.000	1549	1.000	1.000	O60706.pdb.gz	ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens OX=9606 GN=ABCC9 PE=1 SV=2
15	AFDB:P33527	0.775	0.784	0.000	1531	0.309	0.312	P33527.pdb.gz	MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3
16	AFDB:Q54P13	0.747	0.728	0.000	1593	0.318	0.309	Q54P13.pdb.gz	ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum OX=44689 GN=abcC8 PE=3 SV=1
17	AFDB:Q5RH87	0.960	0.955	0.000	1558	0.805	0.800	Q5RH87.pdb.gz	Q5RH87_DANRE ATP-binding cassette sub-family C member 9 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=1
18	AFDB:Q63120	0.759	0.762	0.000	1541	0.301	0.303	Q63120.pdb.gz	MRP2_RAT ATP-binding cassette sub-family C member 2 OS=Rattus norvegicus OX=10116 GN=Abcc2 PE=1 SV=1
19	PDB:7mpeA	0.681	0.733	5.165E-89	1428	0.288	0.312	7mpeA.pdb.gz
20	PDB:5ykeB	0.532	0.966	2.552E-74	845	0.396	0.725	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	742	1215	0.293	0.374	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	583	1408	0.258	0.283	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	2496	1557	0.809	0.805	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	790	1518	0.336	0.343	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	712	1492	0.291	0.302	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1B0GT25	1196	910	0.396	0.674	A0A1B0GT25_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 (Fragment) OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
7	A0A1S4NYG1	2116	1582	0.689	0.675	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
8	A0A1U7R319	2118	1582	0.690	0.676	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
9	A7KVC2	645	1510	0.293	0.301	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
10	B2RUS7	2083	1588	0.689	0.672	B2RUS7_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
11	B2RX12	768	1523	0.305	0.311	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
12	E1B2R7	646	1426	0.259	0.281	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
13	E7EYG0	657	1426	0.285	0.310	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
14	E7F118	700	1507	0.288	0.296	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
15	E9Q236	658	1325	0.284	0.332	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
16	F1LR52	642	1288	0.270	0.325	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
17	F1M3J4	649	1325	0.278	0.325	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
18	G3I1T3	1738	2352	0.589	0.388	G3I1T3_CRIGR ATP-sensitive inward rectifier potassium channel 11 (Fragment) OS=Cricetulus griseus OX=10029 GN=I79_017352 PE=1 SV=1
19	I3L4X2	768	1440	0.310	0.333	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
20	O15438	758	1527	0.307	0.311	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	5.9e+02	11.4	AAA ATPase domain
2	PF13191 AAA_16	81	15.0	AAA ATPase domain
3	PF13304 AAA_21	0.43	21.9	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	28	16.4	AAA domain
5	PF13481 AAA_25	29	15.7	AAA domain
6	PF13555 AAA_29	0.79	20.8	P-loop containing region of AAA domain
7	PF12775 AAA_7	97	13.9	P-loop containing dynein motor region
8	PF09818 ABC_ATPase	0.23	22.0	ATPase of the ABC class
9	PF00664 ABC_membrane	2.8e-66	235.6	ABC transporter transmembrane region
10	PF00005 ABC_tran	2e-48	175.8	ABC transporter
11	PF00006 ATP-synt_ab	6.7e+02	11.3	ATP synthase alpha/beta family, nucleotide-binding domain
12	PF05673 DUF815	2.3e+02	12.3	Protein of unknown function (DUF815)
13	PF01926 MMR_HSR1	2.3	19.7	50S ribosome-binding GTPase
14	PF03193 RsgA_GTPase	0.17	23.3	RsgA GTPase
15	PF00158 Sigma54_activat	3.6e+02	12.3	Sigma-54 interaction domain
16	PF02463 SMC_N	0.024	25.6	RecF/RecN/SMC N terminal domain
17	PF06414 Zeta_toxin	30	15.4	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000058431

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000048229	0.953	Potassium inwardly-rectifying channel, subfamily J, member 11
2	9598.ENSPTRP00000008130	0.941	Potassium inwardly-rectifying channel, subfamily J, member 8
3	9598.ENSPTRP00000007639	0.693	Uncharacterized protein
4	9598.ENSPTRP00000007384	0.647	Ubiquitin specific peptidase 28
5	9598.ENSPTRP00000002760	0.625	Solute carrier family 19 (Thiamine transporter), member 2
6	9598.ENSPTRP00000043026	0.621	Solute carrier organic anion transporter family, member 1A2
7	9598.ENSPTRP00000007641	0.595	Potassium inwardly-rectifying channel, subfamily J, member 5
8	9598.ENSPTRP00000016291	0.580	Potassium inwardly-rectifying channel, subfamily J, member 2
9	9598.ENSPTRP00000001966	0.564	Calsequestrin
10	9598.ENSPTRP00000050160	0.562	Uncharacterized protein
11	9598.ENSPTRP00000048809	0.551	Sodium channel subunit beta-1
12	9598.ENSPTRP00000061317	0.551	Potassium voltage-gated channel, Isk-related family, member 3
13	9598.ENSPTRP00000060411	0.542	Potassium voltage-gated channel subfamily E regulatory subunit 5
14	9598.ENSPTRP00000049031	0.538	Uncharacterized protein
15	9598.ENSPTRP00000034798	0.523	Solute carrier organic anion transporter family, member 5A1
16	9598.ENSPTRP00000047868	0.516	A kinase (PRKA) anchor protein (Yotiao) 9
17	9598.ENSPTRP00000044995	0.504	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005267	0.998	potassium channel activity
GO:0140657	0.995	ATP-dependent activity
GO:0022804	0.995	active transmembrane transporter activity
GO:0005488	0.994	binding
GO:0042626	0.993	ATPase-coupled transmembrane transporter activity
GO:0005515	0.971	protein binding
GO:0022836	0.790	gated channel activity
GO:0022843	0.765	voltage-gated monoatomic cation channel activity
GO:0022853	0.491	active monoatomic ion transmembrane transporter activity
GO:0019829	0.446	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0005242	0.321	inward rectifier potassium channel activity
GO:0015103	0.312	inorganic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.979	biological regulation
GO:0050789	0.971	regulation of biological process
GO:0009987	0.928	cellular process
GO:0051179	0.840	localization
GO:1903522	0.797	regulation of blood circulation
GO:0008016	0.760	regulation of heart contraction
GO:0051234	0.726	establishment of localization
GO:0006810	0.720	transport
GO:0050896	0.555	response to stimulus
GO:0055085	0.550	transmembrane transport
GO:0030001	0.513	metal ion transport
GO:0050794	0.504	regulation of cellular process
GO:0098662	0.444	inorganic cation transmembrane transport
GO:0034220	0.432	monoatomic ion transmembrane transport
GO:0032501	0.429	multicellular organismal process
GO:0098655	0.359	monoatomic cation transmembrane transport
GO:0006813	0.341	potassium ion transport
GO:0065008	0.329	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.993	protein-containing complex
GO:0043226	0.924	organelle
GO:0005622	0.920	intracellular anatomical structure
GO:0098796	0.893	membrane protein complex
GO:0098797	0.872	plasma membrane protein complex
GO:1902495	0.853	transmembrane transporter complex
GO:0034703	0.826	cation channel complex
GO:0005737	0.820	cytoplasm
GO:0043229	0.706	intracellular organelle
GO:0043227	0.695	membrane-bounded organelle
GO:0043231	0.517	intracellular membrane-bounded organelle
GO:0034705	0.392	potassium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.999	K(+)(in) = K(+)(out)
EC:7.-.-.-	0.993	Translocases.

[back to server]