StarFunc result for job id O60711

User Input

>input (386 residues)
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQL
VYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPD
KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTH
CKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLT
QLSKGIFREQNDKTYCQPCFNKLFPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60711	1.000	1.000	6.651E-75	386	1.000	1.000	O60711.pdb.gz	LPXN_HUMAN Leupaxin OS=Homo sapiens OX=9606 GN=LPXN PE=1 SV=1
2	AFDB:Q99N69	0.661	0.661	1.251E-60	386	0.852	0.852	Q99N69.pdb.gz	LPXN_MOUSE Leupaxin OS=Mus musculus OX=10090 GN=Lpxn PE=1 SV=2
3	AFDB:P49024	0.599	0.434	3.828E-46	559	0.552	0.381	P49024.pdb.gz	PAXI_CHICK Paxillin OS=Gallus gallus OX=9031 GN=PXN PE=1 SV=1
4	AFDB:Q66H76	0.573	0.403	7.946E-46	586	0.528	0.348	Q66H76.pdb.gz	PAXI_RAT Paxillin OS=Rattus norvegicus OX=10116 GN=Pxn PE=1 SV=1
5	AFDB:A0A140VJQ8	0.524	0.363	3.639E-45	591	0.562	0.367	A0A140VJQ8.pdb.gz	A0A140VJQ8_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=2 SV=1
6	AFDB:Q6R3L1	0.610	0.462	1.088E-44	533	0.536	0.388	Q6R3L1.pdb.gz	Q6R3L1_DANRE Paxillin OS=Danio rerio OX=7955 GN=pxn PE=1 SV=1
7	AFDB:E7F7U1	0.535	0.412	2.148E-43	525	0.526	0.387	E7F7U1.pdb.gz
8	AFDB:A0A1B0GTU4	0.511	0.209	4.196E-43	1081	0.495	0.177	A0A1B0GTU4.pdb.gz	A0A1B0GTU4_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=1
9	AFDB:Q2PDT4	0.562	0.392	2.452E-42	581	0.490	0.325	Q2PDT4.pdb.gz	Q2PDT4_DROME Paxillin, isoform F OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
10	AFDB:O43294	0.586	0.498	2.687E-39	461	0.474	0.397	O43294.pdb.gz	TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=2
11	PDB:4kfzB	0.162	0.376	9.198E-9	148	0.085	0.223	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.156	0.298	4.908E-5	192	0.080	0.161	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.141	0.573	1.483E-3	76	0.047	0.237	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:7uhyC	0.051	0.039	7.832E-1	578	0.049	0.033	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7od1A	0.106	0.097	1.062	430	0.109	0.098	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:7uhyD	0.045	0.058	1.836	288	0.044	0.059	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:7n9sA	0.070	0.018	2.342	2365	0.047	0.008	7n9sA.pdb.gz
18	PDB:7b5lH	0.072	0.067	2.988	423	0.036	0.033	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
19	PDB:7zu0C	0.063	0.033	3.587	842	0.034	0.015	7zu0C.pdb.gz
20	PDB:1tjlA	0.067	0.165	4.863	145	0.062	0.166	1tjlA.pdb.gz	Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60711	0.0	804	386	1.000	1.000	LPXN_HUMAN Leupaxin OS=Homo sapiens OX=9606 GN=LPXN PE=1 SV=1
2	Q99N69	0.0	648	386	0.821	0.821	LPXN_MOUSE Leupaxin OS=Mus musculus OX=10090 GN=Lpxn PE=1 SV=2
3	F1NB68	9.84e-150	436	557	0.523	0.363	F1NB68_CHICK Paxillin OS=Gallus gallus OX=9031 GN=PXN PE=3 SV=4
4	G1N9N2	1.15e-149	436	557	0.523	0.363	G1N9N2_MELGA Paxillin OS=Meleagris gallopavo OX=9103 GN=PXN PE=3 SV=2
5	P49024	1.36e-149	436	559	0.523	0.361	PAXI_CHICK Paxillin OS=Gallus gallus OX=9031 GN=PXN PE=1 SV=1
6	Q66H76	2.33e-149	436	586	0.526	0.346	PAXI_RAT Paxillin OS=Rattus norvegicus OX=10116 GN=Pxn PE=1 SV=1
7	Q6R3L1	2.64e-148	432	533	0.508	0.368	Q6R3L1_DANRE Paxillin OS=Danio rerio OX=7955 GN=pxn PE=1 SV=1
8	F5GZ78	3.91e-146	428	589	0.531	0.348	F5GZ78_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=1
9	A0A140VJQ8	4.35e-146	428	591	0.531	0.347	A0A140VJQ8_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=2 SV=1
10	P49023	4.35e-146	428	591	0.531	0.347	PAXI_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3
11	Q8VI36	3.07e-145	426	591	0.526	0.343	PAXI_MOUSE Paxillin OS=Mus musculus OX=10090 GN=Pxn PE=1 SV=1
12	F1MFD1	7.70e-144	422	586	0.526	0.346	F1MFD1_BOVIN Paxillin OS=Bos taurus OX=9913 GN=PXN PE=1 SV=3
13	A0A1B0GTU4	4.31e-138	422	1081	0.469	0.167	A0A1B0GTU4_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=1
14	Q8MQX3	7.52e-129	383	557	0.487	0.338	Q8MQX3_DROME SD04793p OS=Drosophila melanogaster OX=7227 GN=Pax PE=2 SV=1
15	Q8INW7	8.94e-129	383	557	0.487	0.338	Q8INW7_DROME FI11475p OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
16	Q9VIX3	9.88e-129	383	556	0.487	0.338	Q9VIX3_DROME Paxillin, isoform B OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=2
17	D3DMM0	1.05e-128	383	563	0.487	0.334	D3DMM0_DROME MIP15702p OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
18	Q2PDT4	1.40e-128	383	581	0.487	0.324	Q2PDT4_DROME Paxillin, isoform F OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
19	Q9GSE0	1.59e-128	382	556	0.433	0.300	Q9GSE0_DROME Focal contact protein paxillin OS=Drosophila melanogaster OX=7227 GN=Pax PE=2 SV=1
20	Q9BPQ9	2.01e-128	383	581	0.487	0.324	Q9BPQ9_DROME Paxillin OS=Drosophila melanogaster OX=7227 GN=Pax PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18912 DZR_2	3.7e+02	12.4	Double zinc ribbon domain
2	PF00412 LIM	5.5e-57	201.2	LIM domain
3	PF09552 RE_BstXI	5.2e+02	11.2	BstXI restriction endonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000006351

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000034416	0.941	PTK2B protein tyrosine kinase 2 beta
2	9598.ENSPTRP00000035264	0.799	Belongs to the protein kinase superfamily. Tyr protein kinase family
3	9598.ENSPTRP00000023137	0.753	Tyrosine-protein kinase
4	9598.ENSPTRP00000059565	0.738	Uncharacterized protein
5	9598.ENSPTRP00000004598	0.715	Vinculin
6	9598.ENSPTRP00000029880	0.701	C1q and tumor necrosis factor related protein 2
7	9598.ENSPTRP00000029878	0.689	Uncharacterized protein
8	9598.ENSPTRP00000033071	0.650	Protein tyrosine phosphatase, non-receptor type 12
9	9598.ENSPTRP00000010269	0.642	Rho guanine nucleotide exchange factor (GEF) 7
10	9598.ENSPTRP00000059492	0.630	G protein-coupled receptor kinase interacting ArfGAP 1
11	9598.ENSPTRP00000005773	0.629	Integrin-linked kinase
12	9598.ENSPTRP00000026335	0.627	Hematopoietic cell-specific Lyn substrate 1
13	9598.ENSPTRP00000056154	0.618	Neural precursor cell expressed, developmentally down-regulated 9
14	9598.ENSPTRP00000046677	0.597	Uncharacterized protein
15	9598.ENSPTRP00000031139	0.596	Uncharacterized protein
16	9598.ENSPTRP00000008512	0.589	Uncharacterized protein
17	9598.ENSPTRP00000022062	0.589	Uncharacterized protein
18	9598.ENSPTRP00000041684	0.589	Tensin 3
19	9598.ENSPTRP00000009376	0.585	GCN1 general control of amino-acid synthesis 1-like 1
20	9598.ENSPTRP00000015688	0.585	Tubulin gamma chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003712	1.000	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.976	cellular process
GO:0048583	0.951	regulation of response to stimulus
GO:0048519	0.933	negative regulation of biological process
GO:0030155	0.910	regulation of cell adhesion
GO:0009966	0.899	regulation of signal transduction
GO:0048523	0.880	negative regulation of cellular process
GO:0002682	0.874	regulation of immune system process
GO:0050776	0.786	regulation of immune response
GO:0002683	0.757	negative regulation of immune system process
GO:0050854	0.753	regulation of antigen receptor-mediated signaling pathway
GO:0050896	0.623	response to stimulus
GO:0071840	0.527	cellular component organization or biogenesis
GO:0016043	0.496	cellular component organization
GO:0007154	0.489	cell communication
GO:0023052	0.487	signaling
GO:0023057	0.478	negative regulation of signaling
GO:0051716	0.463	cellular response to stimulus
GO:0007165	0.451	signal transduction
GO:0010648	0.447	negative regulation of cell communication
GO:0009968	0.406	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0070161	0.996	anchoring junction
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005925	0.985	focal adhesion
GO:0031974	0.978	membrane-enclosed lumen
GO:0005856	0.977	cytoskeleton
GO:0005829	0.975	cytosol
GO:0070013	0.973	intracellular organelle lumen
GO:0005634	0.959	nucleus
GO:0071944	0.940	cell periphery
GO:0015629	0.922	actin cytoskeleton
GO:0002102	0.908	podosome
GO:0031981	0.882	nuclear lumen
GO:0016020	0.852	membrane
GO:0005886	0.617	plasma membrane
GO:0005654	0.467	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]