StarFunc result for job id O60716

User Input

>input (968 residues)
MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTL
TRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGA
MSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR
DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEER
YRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMS
DYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP
PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHP
KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLS
SHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE
RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERY
QEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLF
QPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLT
NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILN
TINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE
KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSL
DNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQV
SYPSMQKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60716	1.000	1.000	5.428E-104	968	1.000	1.000	O60716.pdb.gz	CTND1_HUMAN Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
2	AFDB:O00192	0.541	0.545	2.510E-53	962	0.463	0.466	O00192.pdb.gz	ARVC_HUMAN Splicing regulator ARVCF OS=Homo sapiens OX=9606 GN=ARVCF PE=1 SV=1
3	AFDB:Q99569	0.460	0.376	1.123E-35	1192	0.349	0.284	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
4	PDB:2z6gA	0.282	0.443	5.063E-10	550	0.101	0.178	2z6gA.pdb.gz
5	PDB:1wa5B	0.322	0.614	2.407E-8	466	0.075	0.157	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
6	AFDB:Q14669	0.283	0.151	3.357E-8	1992	0.146	0.071	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
7	PDB:7rroH7	0.338	0.545	5.903E-8	580	0.082	0.136	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
8	PDB:4r0zA	0.285	0.445	1.627E-7	557	0.085	0.147	4r0zA.pdb.gz
9	PDB:4tnmA	0.326	0.728	1.692E-7	407	0.072	0.172	4tnmA.pdb.gz
10	PDB:5tbkA	0.335	0.716	4.665E-7	417	0.075	0.175	5tbkA.pdb.gz
11	PDB:6kbnC	0.327	0.598	8.374E-7	504	0.075	0.145	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
12	PDB:3tpoA	0.281	0.528	1.100E-6	438	0.070	0.155	3tpoA.pdb.gz
13	AFDB:Q5H9R4	0.226	0.100	1.476E-6	2290	0.098	0.041	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
14	PDB:7nscE	0.272	0.389	5.445E-6	615	0.071	0.112	7nscE.pdb.gz
15	AFDB:E3W994	0.141	0.112	7.026E-6	1273	0.132	0.101	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
16	AFDB:P25822	0.112	0.080	1.167E-5	1533	0.123	0.078	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
17	PDB:4jlqA	0.286	0.323	1.972E-5	840	0.063	0.073	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
18	AFDB:J9VI91	0.171	0.173	7.887E-5	950	0.127	0.129	J9VI91.pdb.gz	J9VI91_CRYNH Pumilio-family RNA binding protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_02810 PE=4 SV=2
19	AFDB:A0A0R4IZ84	0.105	0.083	1.078E-4	1544	0.128	0.080	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
20	AFDB:B0M0P8	0.110	0.056	1.310E-4	2356	0.116	0.048	B0M0P8.pdb.gz	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JXM1	0.0	1956	967	0.978	0.979	A0A0G2JXM1_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
2	A0A286Y8C1	0.0	993	931	0.581	0.604	A0A286Y8C1_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2
3	A0A669KB05	0.0	1881	915	0.943	0.998	A0A669KB05_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
4	A0A669KB62	0.0	1805	888	0.915	0.998	A0A669KB62_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
5	A0A8I5ZVG2	0.0	1756	870	0.877	0.976	A0A8I5ZVG2_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
6	C9JZR2	0.0	1943	938	0.967	0.998	C9JZR2_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=2
7	D3ZZZ9	0.0	1801	892	0.903	0.980	D3ZZZ9_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=2
8	F1R6C8	0.0	973	908	0.575	0.613	F1R6C8_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2
9	O00192	0.0	748	962	0.467	0.470	ARVC_HUMAN Splicing regulator ARVCF OS=Homo sapiens OX=9606 GN=ARVCF PE=1 SV=1
10	O60716	0.0	2006	968	1.000	1.000	CTND1_HUMAN Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
11	P30999	0.0	1895	938	0.945	0.975	CTND1_MOUSE Catenin delta-1 OS=Mus musculus OX=10090 GN=Ctnnd1 PE=1 SV=2
12	P98203	0.0	764	962	0.474	0.477	ARVC_MOUSE Splicing regulator ARVCF OS=Mus musculus OX=10090 GN=Arvcf PE=1 SV=2
13	Q8AXM9	0.0	794	859	0.492	0.554	CTND1_XENLA Catenin delta-1 OS=Xenopus laevis OX=8355 GN=ctnnd1 PE=1 SV=1
14	Q9UQB3	3.61e-150	478	1225	0.274	0.216	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
15	B0V2S9	4.44e-144	462	1210	0.263	0.211	B0V2S9_DANRE Catenin (cadherin-associated protein), delta 2b OS=Danio rerio OX=7955 GN=ctnnd2 PE=1 SV=1
16	O35927	1.70e-142	458	1247	0.274	0.213	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
17	Q68FH0	6.93e-140	450	1190	0.249	0.203	PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=1 SV=1
18	Q99569	3.61e-139	448	1192	0.248	0.201	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
19	Q8T0H3	1.55e-119	378	562	0.224	0.386	Q8T0H3_DROME LD03740p OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1
20	Q9NHP1	1.88e-118	382	781	0.224	0.278	Q9NHP1_DROME Arm repeat protein OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	1.3e-31	118.9	Armadillo/beta-catenin-like repeat
2	PF04826 Arm_2	1.7e+02	13.1	Armadillo-like
3	PF09759 Atx10homo_assoc	53	15.2	Spinocerebellar ataxia type 10 protein domain
4	PF12717 Cnd1	9.9	17.7	non-SMC mitotic condensation complex subunit 1
5	PF05890 Ebp2	18	16.4	Eukaryotic rRNA processing protein EBP2
6	PF02985 HEAT	2.3e+02	13.5	HEAT repeat
7	PF13646 HEAT_2	1.8	20.3	HEAT repeats
8	PF13513 HEAT_EZ	0.0018	30.1	HEAT-like repeat
9	PF19026 HYPK_UBA	3.2e+02	12.1	HYPK UBA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382004

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261769	0.999	Cadherin-1
2	9606.ENSP00000269141	0.999	Cadherin-2
3	9606.ENSP00000314153	0.999	Transcriptional regulator Kaiso
4	9606.ENSP00000344115	0.999	Cadherin-5
5	9606.ENSP00000344456	0.999	Catenin beta-1
6	9606.ENSP00000347883	0.999	Pleckstrin homology domain-containing family A member 7
7	9606.ENSP00000400175	0.999	Transforming protein RhoA
8	9606.ENSP00000375960	0.998	Afadin
9	9606.ENSP00000362680	0.997	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000027335	0.996	Cadherin-17
11	9606.ENSP00000360916	0.996	Guanine nucleotide exchange factor VAV2
12	9606.ENSP00000346671	0.995	Tyrosine-protein kinase Fyn
13	9606.ENSP00000365745	0.994	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
14	9606.ENSP00000275493	0.993	Epidermal growth factor receptor
15	9606.ENSP00000304669	0.992	Catenin alpha-1
16	9606.ENSP00000385720	0.992	Rho GTPase-activating protein 35
17	9606.ENSP00000281537	0.990	Tight junction protein ZO-1
18	9606.ENSP00000211998	0.985	Vinculin
19	9606.ENSP00000377508	0.985	Junction plakoglobin
20	9606.ENSP00000326366	0.980	Presenilin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	1.000	cell adhesion molecule binding
GO:0019901	0.998	protein kinase binding
GO:0008013	0.997	beta-catenin binding
GO:1990782	0.979	protein tyrosine kinase binding
GO:0045296	0.976	cadherin binding
GO:0005102	0.943	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.988	multicellular organismal process
GO:0009987	0.986	cellular process
GO:0048856	0.983	anatomical structure development
GO:0007275	0.972	multicellular organism development
GO:0048731	0.942	system development
GO:0065007	0.925	biological regulation
GO:0050794	0.908	regulation of cellular process
GO:0048513	0.896	animal organ development
GO:0060322	0.827	head development
GO:0048583	0.742	regulation of response to stimulus
GO:0007399	0.742	nervous system development
GO:0048519	0.725	negative regulation of biological process
GO:0048523	0.684	negative regulation of cellular process
GO:0009966	0.670	regulation of signal transduction
GO:0048518	0.627	positive regulation of biological process
GO:0007420	0.593	brain development
GO:0007155	0.486	cell adhesion
GO:0048522	0.438	positive regulation of cellular process
GO:0050896	0.373	response to stimulus
GO:0019222	0.355	regulation of metabolic process
GO:0065008	0.314	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.995	intracellular anatomical structure
GO:0005737	0.991	cytoplasm
GO:0005634	0.988	nucleus
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0005829	0.931	cytosol
GO:0070161	0.919	anchoring junction
GO:0005911	0.881	cell-cell junction
GO:0005912	0.628	adherens junction
GO:0031252	0.577	cell leading edge
GO:0032991	0.563	protein-containing complex
GO:0120025	0.507	plasma membrane bounded cell projection
GO:0031982	0.469	vesicle
GO:0043296	0.458	apical junction complex
GO:0098797	0.387	plasma membrane protein complex
GO:0030027	0.382	lamellipodium
GO:0045202	0.367	synapse
GO:0030424	0.348	axon
GO:0036477	0.345	somatodendritic compartment
GO:0019898	0.344	extrinsic component of membrane
GO:0030496	0.343	midbody
GO:0097447	0.342	dendritic tree
GO:0098794	0.335	postsynapse
GO:0005938	0.333	cell cortex
GO:0019897	0.331	extrinsic component of plasma membrane
GO:0030425	0.329	dendrite
GO:0016342	0.314	catenin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]