StarFunc result for job id O60721

User Input

>input (1099 residues)
MGKLIRMGPQERWLLRTKRLHWSRLLFLLGMLIIGSTYQHLRRPRGLSSLWAAVSSHQPI
KLASRDLSSEEMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATLSMTVENIPSMPKRTAK
MIPTTTKNNYSPTAAGTERRKEDTPTSSRTLTYYTSTSSRQIVKKYTPTPRGEMKSYSPT
QVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRI
MEETTPTTLKGMFDSTPTFLTHEVEANVLTSPRSVMEKNNLFPPRRVESNSSAHPWGLVG
KSNPKTPQGTVLLHTPATSEGQVTISTMTGSSPAETKAFTAAWSLRNPSPRTSVSAIKTA
PAIVWRLAKKPSTAPSTSTTPTVRAKLTMQVHHCVVVKPTPAMLTTPSPSLTTALLPEEL
SPSPSVLPPSLPDLHPKGEYPPDLFSVEERRQGWVVLHVFGMMYVFVALAIVCDEYFVPA
LGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVI
GTCSLFSREILNLTWWPLFRDVSFYILDLIMLILFFLDSLIAWWESLLLLLAYAFYVFTM
KWNKHIEVWVKEQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSST
SLHNSTIRSTIYQLMLHSLDPLREVRLAKEKEEESLNQGARAQPQAKAESKPEEEEPAKL
PAVTVTPAPVPDIKGDQKENPGGQEDVAEAESTGEMPGEEGETAGEGETEEKSGGETQPE
GEGETETQGKGEECEDENEAEGKGDNEGEDEGEIHAEDGEMKGNEGETESQELSAENHGE
AKNDEKGVEDGGGSDGGDSEEEEEEEEEQEEEEEEEEQEEEEEEEEEEEEKGNEEPLSLD
WPETRQKQAIYLFLLPIVFPLWLTVPDVRRQESRKFFVFTFLGSIMWIAMFSYLMVWWAH
QVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPV
PWLLFSLINGLQPVPVSSNGLFCAIVLLFLMLLFVISSIASCKWRMNKILGFTMFLLYFV
FLIISVMLEDRIISCPVSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60721	1.000	1.000	0.000	1099	1.000	1.000	O60721.pdb.gz	NCKX1_HUMAN Sodium/potassium/calcium exchanger 1 OS=Homo sapiens OX=9606 GN=SLC24A1 PE=1 SV=1
2	AFDB:Q28139	0.440	0.402	2.251E-85	1216	0.727	0.657	Q28139.pdb.gz	NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus OX=9913 GN=SLC24A1 PE=1 SV=2
3	AFDB:Q9IAL8	0.398	0.645	4.305E-52	663	0.369	0.612	Q9IAL8.pdb.gz	NCKX1_CHICK Sodium/potassium/calcium exchanger 1 OS=Gallus gallus OX=9031 GN=SLC24A1 PE=2 SV=1
4	PDB:4kjrA	0.121	0.367	1.215E-2	325	0.035	0.120	4kjrA.pdb.gz
5	PDB:4k1cA	0.124	0.345	2.882E-2	374	0.030	0.088	4k1cA.pdb.gz	Structural basis for alternating access of a eukaryotic calcium/proton exchanger.
6	AFDB:Q8IWC1	0.045	0.054	2.219E-1	876	0.096	0.121	Q8IWC1.pdb.gz	MA7D3_HUMAN MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3 PE=1 SV=2
7	AFDB:Q8I398	0.044	0.027	2.430E-1	2112	0.103	0.054	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
8	AFDB:Q8IPM1	0.040	0.041	3.828E-1	1067	0.092	0.095	Q8IPM1.pdb.gz	Q8IPM1_DROME FI18188p1 OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=2
9	AFDB:O94913	0.047	0.040	4.388E-1	1555	0.105	0.074	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
10	AFDB:P51521	0.046	0.040	4.592E-1	1351	0.102	0.083	P51521.pdb.gz	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2
11	AFDB:Q6AWQ1	0.041	0.046	4.592E-1	954	0.103	0.118	Q6AWQ1.pdb.gz	Q6AWQ1_DROME RE71183p OS=Drosophila melanogaster OX=7227 GN=Srrm1 PE=2 SV=1
12	AFDB:Q8W1Y0	0.033	0.034	4.805E-1	1031	0.095	0.101	Q8W1Y0.pdb.gz	SSC14_ARATH Sister chromatid cohesion 1 protein 4 OS=Arabidopsis thaliana OX=3702 GN=SYN4 PE=2 SV=1
13	PDB:5yqzR	0.040	0.063	4.277	558	0.035	0.068	5yqzR.pdb.gz	Structure of the glucagon receptor in complex with a glucagon analogue.
14	PDB:7oseA	0.038	0.067	6.152	503	0.025	0.054	7oseA.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
15	PDB:4k5yA	0.049	0.102	7.379	407	0.026	0.071	4k5yA.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
16	PDB:7b04B	0.033	0.033	8.081	1120	0.004	0.004	7b04B.pdb.gz	Structural and functional characterization of the intracellular filament-forming nitrite oxidoreductase multiprotein complex
17	PDB:6kjvB	0.052	0.101	9.692	424	0.031	0.080	6kjvB.pdb.gz	Mutagenesis facilitated crystallization of GLP-1R.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60721	0.0	2237	1099	1.000	1.000	NCKX1_HUMAN Sodium/potassium/calcium exchanger 1 OS=Homo sapiens OX=9606 GN=SLC24A1 PE=1 SV=1
2	Q28139	0.0	1053	1216	0.518	0.468	NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus OX=9913 GN=SLC24A1 PE=1 SV=2
3	Q9QZM6	0.0	1291	1181	0.685	0.638	NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Rattus norvegicus OX=10116 GN=Slc24a1 PE=2 SV=1
4	Q9IAL8	5.10e-129	410	663	0.200	0.332	NCKX1_CHICK Sodium/potassium/calcium exchanger 1 OS=Gallus gallus OX=9031 GN=SLC24A1 PE=2 SV=1
5	Q9UI40	3.71e-110	360	661	0.173	0.287	NCKX2_HUMAN Sodium/potassium/calcium exchanger 2 OS=Homo sapiens OX=9606 GN=SLC24A2 PE=1 SV=1
6	Q8BUN9	6.17e-108	354	666	0.155	0.255	NCKX2_MOUSE Sodium/potassium/calcium exchanger 2 OS=Mus musculus OX=10090 GN=Slc24a2 PE=1 SV=1
7	O54701	1.52e-107	353	670	0.157	0.257	NCKX2_RAT Sodium/potassium/calcium exchanger 2 OS=Rattus norvegicus OX=10116 GN=Slc24a2 PE=1 SV=1
8	Q9IAL7	8.48e-107	350	651	0.150	0.253	NCKX2_CHICK Sodium/potassium/calcium exchanger 2 OS=Gallus gallus OX=9031 GN=SLC24A2 PE=2 SV=1
9	Q9U6A0	1.82e-79	281	881	0.131	0.163	NCKX_DROME Sodium/potassium/calcium exchanger Nckx30C OS=Drosophila melanogaster OX=7227 GN=Nckx30C PE=2 SV=4
10	F1QXK9	1.63e-61	224	636	0.115	0.198	F1QXK9_DANRE Sodium/potassium/calcium exchanger 4 OS=Danio rerio OX=7955 GN=slc24a4b PE=3 SV=1
11	A0A8J8XAJ2	1.45e-60	219	566	0.096	0.187	A0A8J8XAJ2_RAT Slc24a4 protein OS=Rattus norvegicus OX=10116 GN=Slc24a4 PE=2 SV=1
12	A0A0G2K3S9	1.52e-60	221	622	0.098	0.174	A0A0G2K3S9_RAT Solute carrier family 24 member 4 OS=Rattus norvegicus OX=10116 GN=Slc24a4 PE=3 SV=1
13	Q8CGQ8	1.77e-60	221	622	0.098	0.174	NCKX4_MOUSE Sodium/potassium/calcium exchanger 4 OS=Mus musculus OX=10090 GN=Slc24a4 PE=1 SV=2
14	F6S7H4	2.94e-60	220	622	0.089	0.158	F6S7H4_MACMU Solute carrier family 24 member 4 OS=Macaca mulatta OX=9544 GN=SLC24A4 PE=3 SV=3
15	Q8NFF2	4.22e-60	220	622	0.089	0.158	NCKX4_HUMAN Sodium/potassium/calcium exchanger 4 OS=Homo sapiens OX=9606 GN=SLC24A4 PE=1 SV=2
16	Q9EPQ0	2.62e-59	218	624	0.094	0.165	NCKX3_RAT Sodium/potassium/calcium exchanger 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Slc24a3 PE=1 SV=1
17	Q99PD7	5.24e-59	217	645	0.094	0.160	NCKX3_MOUSE Sodium/potassium/calcium exchanger 3 OS=Mus musculus OX=10090 GN=Slc24a3 PE=1 SV=3
18	Q9HC58	1.43e-58	216	644	0.093	0.158	NCKX3_HUMAN Sodium/potassium/calcium exchanger 3 OS=Homo sapiens OX=9606 GN=SLC24A3 PE=2 SV=4
19	D3ZCC3	1.80e-56	208	568	0.095	0.183	D3ZCC3_RAT Solute carrier family 24 member 4 OS=Rattus norvegicus OX=10116 GN=Slc24a4 PE=3 SV=3
20	A0A021WZA4	5.99e-46	175	499	0.080	0.176	A0A021WZA4_DROME Zydeco, isoform G OS=Drosophila melanogaster OX=7227 GN=zyd PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01699 Na_Ca_ex	1.2e-54	195.8	Sodium/calcium exchanger protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261892

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384264	0.754	cGMP-gated cation channel alpha-1
2	9606.ENSP00000360502	0.738	Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
3	9606.ENSP00000384763	0.676	Sodium/calcium exchanger 1
4	9606.ENSP00000232461	0.629	Guanine nucleotide-binding protein G(t) subunit alpha-1
5	9606.ENSP00000469759	0.625	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3
6	9606.ENSP00000377784	0.618	Guanylyl cyclase-activating protein 1
7	9606.ENSP00000324960	0.609	Calcium-binding protein 4
8	9606.ENSP00000270593	0.606	Testicular acid phosphatase
9	9606.ENSP00000439378	0.603	Protein SSUH2 homolog
10	9606.ENSP00000328412	0.591	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
11	9606.ENSP00000251102	0.586	Cyclic nucleotide-gated cation channel beta-1
12	9606.ENSP00000483469	0.580	Probable G-protein coupled receptor 179
13	9606.ENSP00000377140	0.577	Cyclic nucleotide-gated cation channel alpha-3
14	9606.ENSP00000414886	0.551	Potassium voltage-gated channel interacting protein 1
15	9606.ENSP00000420295	0.548	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
16	9606.ENSP00000400895	0.543	Otogelin-like protein
17	9606.ENSP00000220853	0.539	ER membrane protein complex subunit 2
18	9606.ENSP00000255266	0.534	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
19	9606.ENSP00000340328	0.533	Nyctalopin
20	9606.ENSP00000365441	0.525	Voltage-dependent L-type calcium channel subunit alpha-1F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008273	1.000	calcium, potassium:sodium antiporter activity
GO:0005488	0.998	binding
GO:0005515	0.993	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0051234	0.995	establishment of localization
GO:0055085	0.993	transmembrane transport
GO:0070588	0.983	calcium ion transmembrane transport
GO:0006814	0.925	sodium ion transport
GO:0042592	0.893	homeostatic process
GO:0055082	0.884	intracellular chemical homeostasis
GO:0055080	0.882	monoatomic cation homeostasis
GO:0098771	0.878	inorganic ion homeostasis
GO:0055074	0.821	calcium ion homeostasis
GO:0030003	0.772	intracellular monoatomic cation homeostasis
GO:0006874	0.764	intracellular calcium ion homeostasis
GO:0006813	0.720	potassium ion transport
GO:0035725	0.688	sodium ion transmembrane transport
GO:0071805	0.659	potassium ion transmembrane transport
GO:0065007	0.489	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.385	intracellular anatomical structure
GO:0005737	0.308	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)
RHEA:29255	1.000	Ca(2+)(in) + Na(+)(out) = Ca(2+)(out) + Na(+)(in)

[back to server]