StarFunc result for job id O60729

User Input

>input (498 residues)
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAI
LYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVH
FTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLL
DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY
HQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFL
DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFL
VMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD
EINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSAS
RKSSVKSLSISRTKTVLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60729	1.000	1.000	7.944E-94	498	1.000	1.000	O60729.pdb.gz	CC14B_HUMAN Dual specificity protein phosphatase CDC14B OS=Homo sapiens OX=9606 GN=CDC14B PE=1 SV=1
2	AFDB:F8W2B2	0.749	0.783	1.730E-61	476	0.528	0.553	F8W2B2.pdb.gz	F8W2B2_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=cdc14a PE=1 SV=1
3	AFDB:A0A2R8YDJ8	0.746	0.599	7.021E-60	624	0.542	0.433	A0A2R8YDJ8.pdb.gz	A0A2R8YDJ8_HUMAN Cell division cycle 14A OS=Homo sapiens OX=9606 GN=CDC14A PE=1 SV=1
4	AFDB:Q6GQT0	0.719	0.596	2.542E-57	603	0.514	0.425	Q6GQT0.pdb.gz	CC14A_MOUSE Dual specificity protein phosphatase CDC14A OS=Mus musculus OX=10090 GN=Cdc14a PE=1 SV=2
5	AFDB:A8DZH6	0.716	0.604	5.565E-56	592	0.480	0.404	A8DZH6.pdb.gz
6	AFDB:P81299	0.691	0.490	1.575E-42	709	0.369	0.260	P81299.pdb.gz	CDC14_CAEEL Tyrosine-protein phosphatase cdc-14 OS=Caenorhabditis elegans OX=6239 GN=cdc-14 PE=1 SV=3
7	AFDB:Q00684	0.609	0.552	8.413E-38	551	0.271	0.245	Q00684.pdb.gz	CDC14_YEAST Tyrosine-protein phosphatase CDC14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC14 PE=1 SV=2
8	AFDB:Q9P7H1	0.639	0.595	7.939E-37	537	0.293	0.272	Q9P7H1.pdb.gz	FLP1_SCHPO Tyrosine-protein phosphatase CDC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clp1 PE=1 SV=1
9	AFDB:Q382T8	0.532	0.329	5.902E-29	818	0.275	0.167	Q382T8.pdb.gz	Q382T8_TRYB2 Tyrosine phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4270 PE=3 SV=1
10	AFDB:F8W5R0	0.142	0.330	7.540E-11	210	0.173	0.410	F8W5R0.pdb.gz
11	PDB:3s4oA	0.242	0.715	7.147E-9	163	0.080	0.245	3s4oA.pdb.gz
12	PDB:4ercA	0.272	0.853	1.059E-8	150	0.078	0.260	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
13	PDB:7jvxA	0.276	0.426	2.322E-8	314	0.084	0.134	7jvxA.pdb.gz
14	PDB:5bx1A	0.240	0.722	8.441E-8	153	0.076	0.248	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
15	PDB:6wurA	0.247	0.731	1.958E-7	158	0.070	0.222	6wurA.pdb.gz
16	PDB:1r6hA	0.208	0.510	1.562E-6	172	0.082	0.238	1r6hA.pdb.gz
17	PDB:2wgpA	0.244	0.670	6.004E-6	168	0.062	0.185	2wgpA.pdb.gz
18	PDB:6d66A	0.265	0.256	9.949E-6	517	0.062	0.060	6d66A.pdb.gz
19	PDB:2esbA	0.235	0.653	1.649E-5	162	0.054	0.167	2esbA.pdb.gz
20	PDB:1fq1A	0.269	0.673	2.442E-5	183	0.058	0.158	1fq1A.pdb.gz	Phosphoprotein-protein interactions revealed by the crystal structure of kinase-associated phosphatase in complex with phosphoCDK2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YDJ8	0.0	566	624	0.538	0.429	A0A2R8YDJ8_HUMAN Cell division cycle 14A OS=Homo sapiens OX=9606 GN=CDC14A PE=1 SV=1
2	F8W2B2	0.0	522	476	0.516	0.540	F8W2B2_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=cdc14a PE=1 SV=1
3	O60729	0.0	1048	498	1.000	1.000	CC14B_HUMAN Dual specificity protein phosphatase CDC14B OS=Homo sapiens OX=9606 GN=CDC14B PE=1 SV=1
4	Q6GQT0	0.0	548	603	0.528	0.436	CC14A_MOUSE Dual specificity protein phosphatase CDC14A OS=Mus musculus OX=10090 GN=Cdc14a PE=1 SV=2
5	Q9UNH5	0.0	565	594	0.538	0.451	CC14A_HUMAN Dual specificity protein phosphatase CDC14A OS=Homo sapiens OX=9606 GN=CDC14A PE=1 SV=1
6	Q7SXZ4	4.10e-175	507	592	0.468	0.394	Q7SXZ4_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=zgc:63654 PE=2 SV=1
7	A0A0U1RQX7	2.69e-172	499	565	0.472	0.416	A0A0U1RQX7_HUMAN Cell division cycle 14A OS=Homo sapiens OX=9606 GN=CDC14A PE=1 SV=1
8	A0A2R8Y6L0	4.59e-172	498	552	0.472	0.426	A0A2R8Y6L0_HUMAN Cell division cycle 14A OS=Homo sapiens OX=9606 GN=CDC14A PE=1 SV=1
9	Q7ZVN3	6.46e-159	459	404	0.426	0.525	Q7ZVN3_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=cdc14a PE=1 SV=1
10	P81299	2.12e-110	345	709	0.317	0.223	CDC14_CAEEL Tyrosine-protein phosphatase cdc-14 OS=Caenorhabditis elegans OX=6239 GN=cdc-14 PE=1 SV=3
11	Q9P7H1	2.72e-78	256	537	0.275	0.255	FLP1_SCHPO Tyrosine-protein phosphatase CDC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clp1 PE=1 SV=1
12	Q00684	1.38e-71	239	551	0.247	0.223	CDC14_YEAST Tyrosine-protein phosphatase CDC14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC14 PE=1 SV=2
13	Q382T8	5.01e-45	171	818	0.227	0.138	Q382T8_TRYB2 Tyrosine phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4270 PE=3 SV=1
14	Q8IIN1	1.30e-15	78.2	218	0.092	0.211	Q8IIN1_PLAF7 Protein tyrosine phosphatase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1113100 PE=4 SV=1
15	Q4CUJ8	1.17e-12	68.6	176	0.074	0.210	PRL1_TRYCC Protein tyrosine phosphatase PRL-1 OS=Trypanosoma cruzi (strain CL Brener) OX=353153 GN=PLR-1 PE=1 SV=1
16	A0A140VJI5	1.28e-12	67.8	150	0.092	0.307	A0A140VJI5_HUMAN Dual specificity phosphatase 23 OS=Homo sapiens OX=9606 GN=DUSP23 PE=2 SV=1
17	Q9BVJ7	1.28e-12	67.8	150	0.092	0.307	DUS23_HUMAN Dual specificity protein phosphatase 23 OS=Homo sapiens OX=9606 GN=DUSP23 PE=1 SV=1
18	A0A087WTF0	1.88e-12	72.0	808	0.102	0.063	A0A087WTF0_HUMAN Protein tyrosine phosphatase domain containing 1 OS=Homo sapiens OX=9606 GN=PTPDC1 PE=1 SV=1
19	A2A3K4	2.80e-12	71.6	754	0.102	0.068	PTPC1_HUMAN Protein tyrosine phosphatase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PTPDC1 PE=1 SV=1
20	O61722	3.75e-12	67.0	176	0.072	0.205	PRL1_DROME PRL-1 phosphatase OS=Drosophila melanogaster OX=7227 GN=PRL-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05706 CDKN3	57	14.8	Cyclin-dependent kinase inhibitor 3 (CDKN3)
2	PF00782 DSPc	1.8e-12	58.7	Dual specificity phosphatase, catalytic domain
3	PF14671 DSPn	1.8e-52	189.0	Dual specificity protein phosphatase, N-terminal half
4	PF14566 PTPlike_phytase	0.0071	27.9	Inositol hexakisphosphate
5	PF00102 Y_phosphatase	0.053	24.7	Protein-tyrosine phosphatase
6	PF13350 Y_phosphatase3	39	15.7	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364389

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378529	0.973	Fizzy-related protein homolog
2	9606.ENSP00000362082	0.927	G1/S-specific cyclin-D3
3	9606.ENSP00000354916	0.905	Dual specificity protein phosphatase CDC14A
4	9606.ENSP00000378699	0.776	Cyclin-dependent kinase 1
5	9606.ENSP00000300093	0.766	Serine/threonine-protein kinase PLK1
6	9606.ENSP00000229812	0.761	Serine/threonine-protein kinase 38
7	9606.ENSP00000274289	0.758	Serine/threonine-protein kinase PLK2
8	9606.ENSP00000261845	0.743	Mitogen-activated protein kinase 6
9	9606.ENSP00000265990	0.741	TATA-binding protein-associated factor 172
10	9606.ENSP00000434614	0.740	Cell division cycle protein 27 homolog
11	9606.ENSP00000303706	0.739	M-phase inducer phosphatase 1
12	9606.ENSP00000377793	0.731	Protein regulator of cytokinesis 1
13	9606.ENSP00000321656	0.729	M-phase inducer phosphatase 3
14	9606.ENSP00000219548	0.728	E3 ubiquitin-protein ligase CHIP
15	9606.ENSP00000378350	0.725	Cell division cycle protein 23 homolog
16	9606.ENSP00000373684	0.723	Serine/threonine-protein kinase 38-like
17	9606.ENSP00000245960	0.722	M-phase inducer phosphatase 2
18	9606.ENSP00000353549	0.711	Cell division cycle protein 16 homolog
19	9606.ENSP00000361275	0.698	Serine/threonine-protein kinase PLK3
20	9606.ENSP00000282570	0.672	Germ cell-less protein-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.967	regulation of cellular process
GO:1901990	0.900	regulation of mitotic cell cycle phase transition
GO:0045786	0.895	negative regulation of cell cycle
GO:1901988	0.880	negative regulation of cell cycle phase transition
GO:0000075	0.868	cell cycle checkpoint signaling
GO:1902749	0.846	regulation of cell cycle G2/M phase transition
GO:0071704	0.838	organic substance metabolic process
GO:1903047	0.838	mitotic cell cycle process
GO:0045930	0.819	negative regulation of mitotic cell cycle
GO:1901991	0.812	negative regulation of mitotic cell cycle phase transition
GO:0044238	0.801	primary metabolic process
GO:0007093	0.799	mitotic cell cycle checkpoint signaling
GO:0010389	0.764	regulation of G2/M transition of mitotic cell cycle
GO:0006807	0.763	nitrogen compound metabolic process
GO:0031570	0.752	DNA integrity checkpoint signaling
GO:0044237	0.723	cellular metabolic process
GO:0043170	0.704	macromolecule metabolic process
GO:0044774	0.703	mitotic DNA integrity checkpoint signaling
GO:1902750	0.702	negative regulation of cell cycle G2/M phase transition
GO:0010972	0.691	negative regulation of G2/M transition of mitotic cell cycle
GO:0071840	0.655	cellular component organization or biogenesis
GO:0016043	0.627	cellular component organization
GO:0044818	0.589	mitotic G2/M transition checkpoint
GO:0036211	0.556	protein modification process
GO:0065009	0.548	regulation of molecular function
GO:0019222	0.522	regulation of metabolic process
GO:0006796	0.520	phosphate-containing compound metabolic process
GO:0048518	0.509	positive regulation of biological process
GO:0060255	0.494	regulation of macromolecule metabolic process
GO:0080090	0.490	regulation of primary metabolic process
GO:0051171	0.489	regulation of nitrogen compound metabolic process
GO:0051338	0.469	regulation of transferase activity
GO:0006996	0.444	organelle organization
GO:0006950	0.427	response to stress
GO:0031399	0.406	regulation of protein modification process
GO:0033554	0.355	cellular response to stress
GO:0006974	0.354	cellular response to DNA damage stimulus
GO:0031323	0.352	regulation of cellular metabolic process
GO:0048522	0.314	positive regulation of cellular process
GO:0042770	0.304	signal transduction in response to DNA damage

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	0.997	nucleoplasm
GO:0005730	0.977	nucleolus
GO:0005856	0.788	cytoskeleton
GO:0015630	0.769	microtubule cytoskeleton
GO:0005819	0.517	spindle
GO:0005737	0.430	cytoplasm
GO:0005694	0.372	chromosome
GO:0005829	0.332	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]