StarFunc result for job id O60732

User Input

>input (1142 residues)
MGDKDMPTAGMPSLLQSSSESPQSCPEGEDSQSPLQIPQSSPESDDTLYPLQSPQSRSEG
EDSSDPLQRPPEGKDSQSPLQIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPE
GEDVQSPLQNPASSFFSSALLSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQ
SSPESTQSPFEGFPQSPLQIPVSRSFSSTLLSIFQSSPERTQSTFEGFAQSPLQIPVSPS
SSSTLLSLFQSFSERTQSTFEGFAQSSLQIPVSPSFSSTLVSLFQSSPERTQSTFEGFPQ
SPLQIPVSSSSSSTLLSLFQSSPERTHSTFEGFPQSLLQIPMTSSFSSTLLSIFQSSPES
AQSTFEGFPQSPLQIPGSPSFSSTLLSLFQSSPERTHSTFEGFPQSPLQIPMTSSFSSTL
LSILQSSPESAQSAFEGFPQSPLQIPVSSSFSYTLLSLFQSSPERTHSTFEGFPQSPLQI
PVSSSSSSSTLLSLFQSSPECTQSTFEGFPQSPLQIPQSPPEGENTHSPLQIVPSLPEWE
DSLSPHYFPQSPPQGEDSLSPHYFPQSPPQGEDSLSPHYFPQSPQGEDSLSPHYFPQSPP
QGEDSMSPLYFPQSPLQGEEFQSSLQSPVSICSSSTPSSLPQSFPESSQSPPEGPVQSPL
HSPQSPPEGMHSQSPLQSPESAPEGEDSLSPLQIPQSPLEGEDSLSSLHFPQSPPEWEDS
LSPLHFPQFPPQGEDFQSSLQSPVSICSSSTSLSLPQSFPESPQSPPEGPAQSPLQRPVS
SFFSYTLASLLQSSHESPQSPPEGPAQSPLQSPVSSFPSSTSSSLSQSSPVSSFPSSTSS
SLSKSSPESPLQSPVISFSSSTSLSPFSEESSSPVDEYTSSSDTLLESDSLTDSESLIES
EPLFTYTLDEKVDELARFLLLKYQVKQPITKAEMLTNVISRYTGYFPVIFRKAREFIEIL
FGISLREVDPDDSYVFVNTLDLTSEGCLSDEQGMSQNRLLILILSIIFIKGTYASEEVIW
DVLSGIGVRAGREHFAFGEPRELLTKVWVQEHYLEYREVPNSSPPRYEFLWGPRAHSEVI
KRKVVEFLAMLKNTVPITFPSSYKDALKDVEERAQAIIDTTDDSTATESASSSVMSPSFS
SE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60732	1.000	1.000	0.000	1142	1.000	1.000	O60732.pdb.gz	MAGC1_HUMAN Melanoma-associated antigen C1 OS=Homo sapiens OX=9606 GN=MAGEC1 PE=1 SV=3
2	AFDB:Q9QZ04	0.104	0.094	2.250E-12	1284	0.137	0.121	Q9QZ04.pdb.gz	MAGL2_MOUSE MAGE-like protein 2 OS=Mus musculus OX=10090 GN=Magel2 PE=1 SV=2
3	AFDB:Q9Y5V3	0.095	0.133	2.947E-12	778	0.123	0.181	Q9Y5V3.pdb.gz	MAGD1_HUMAN Melanoma-associated antigen D1 OS=Homo sapiens OX=9606 GN=MAGED1 PE=1 SV=3
4	AFDB:Q9ES73	0.097	0.134	3.373E-12	775	0.129	0.190	Q9ES73.pdb.gz	MAGD1_RAT Melanoma-associated antigen D1 OS=Rattus norvegicus OX=10116 GN=Maged1 PE=1 SV=3
5	AFDB:Q9UJ55	0.095	0.088	4.376E-11	1249	0.151	0.139	Q9UJ55.pdb.gz	MAGL2_HUMAN MAGE-like protein 2 OS=Homo sapiens OX=9606 GN=MAGEL2 PE=1 SV=2
6	AFDB:Q59XA7	0.075	0.072	7.829E-6	1249	0.116	0.106	Q59XA7.pdb.gz	HYR3_CANAL Hyphally regulated cell wall protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HYR3 PE=1 SV=1
7	AFDB:Q388V9	0.100	0.103	1.122E-5	1087	0.101	0.106	Q388V9.pdb.gz	Q388V9_TRYB2 Right handed beta helix domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0660 PE=4 SV=1
8	AFDB:Q5AAL9	0.087	0.072	3.387E-3	1526	0.104	0.078	Q5AAL9.pdb.gz	IFF4_CANAL Cell wall protein IFF4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IFF4 PE=1 SV=1
9	PDB:7qcdE	0.088	0.337	3.693E-3	261	0.029	0.126	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
10	PDB:7tveF	0.093	0.355	3.862E-3	270	0.030	0.126	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
11	AFDB:Q61282	0.094	0.064	1.562E-2	2132	0.133	0.071	Q61282.pdb.gz	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
12	PDB:7a6hO	0.069	0.132	3.826E-2	512	0.026	0.059	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
13	PDB:7z1mO	0.065	0.107	1.177E-1	570	0.032	0.065	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
14	PDB:1w7pD	0.066	0.303	2.417E-1	171	0.028	0.187	1w7pD.pdb.gz
15	PDB:7mqaSW	0.048	0.189	2.528E-1	195	0.021	0.123	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:1u5tA	0.061	0.262	2.893E-1	213	0.023	0.122	1u5tA.pdb.gz
17	PDB:7d58O	0.068	0.135	2.893E-1	490	0.032	0.073	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
18	PDB:6hixBN	0.070	0.311	4.536E-1	214	0.014	0.075	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:6hivBN	0.066	0.287	4.745E-1	214	0.018	0.093	6hivBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	AFDB:A0A024RBB9	0.049	0.057	7.808E-1	911	0.080	0.100	A0A024RBB9.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60732	0.0	2124	1142	1.000	1.000	MAGC1_HUMAN Melanoma-associated antigen C1 OS=Homo sapiens OX=9606 GN=MAGEC1 PE=1 SV=3
2	Q9UBF1	9.60e-109	347	373	0.146	0.448	MAGC2_HUMAN Melanoma-associated antigen C2 OS=Homo sapiens OX=9606 GN=MAGEC2 PE=1 SV=1
3	P43363	3.35e-76	258	369	0.112	0.347	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
4	P43362	1.33e-66	229	315	0.095	0.343	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
5	G5E962	2.81e-66	231	400	0.096	0.275	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
6	P43364	7.23e-66	231	429	0.096	0.256	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
7	P43361	3.06e-64	223	318	0.092	0.330	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
8	Q8TD91	2.10e-62	227	643	0.112	0.199	MAGC3_HUMAN Melanoma-associated antigen C3 OS=Homo sapiens OX=9606 GN=MAGEC3 PE=1 SV=1
9	Q96M61	4.78e-62	217	343	0.087	0.289	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
10	Q1RN33	5.02e-62	216	317	0.091	0.328	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
11	P43358	5.43e-62	216	317	0.091	0.328	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
12	O15481	4.59e-61	214	346	0.091	0.301	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
13	Q96LZ2	3.39e-59	209	347	0.101	0.331	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
14	Q8BQR7	3.28e-58	206	327	0.092	0.321	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
15	O15479	5.38e-57	202	319	0.086	0.307	MAGB2_HUMAN Melanoma-associated antigen B2 OS=Homo sapiens OX=9606 GN=MAGEB2 PE=1 SV=3
16	P43355	1.79e-56	200	309	0.088	0.327	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
17	O15480	3.45e-54	195	346	0.105	0.347	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
18	A2A9R3	3.78e-52	195	556	0.081	0.167	MAGB4_MOUSE Melanoma-associated antigen B4 OS=Mus musculus OX=10090 GN=Mageb4 PE=1 SV=1
19	P43357	7.84e-52	187	314	0.087	0.315	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
20	P43365	7.12e-49	178	314	0.082	0.299	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04819 DUF716	0.82	20.7	Family of unknown function (DUF716)
2	PF01454 MAGE	1.2e-07	43.2	MAGE homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285879

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000469441	0.866	Cancer/testis antigen 1A
2	9606.ENSP00000332602	0.865	Cancer/testis antigen 1B
3	9606.ENSP00000359382	0.859	Circadian clock protein PASD1
4	9606.ENSP00000332151	0.811	Dermatan-sulfate epimerase
5	9606.ENSP00000354660	0.790	Melanoma-associated antigen C2
6	9606.ENSP00000310448	0.766	U4/U6.U5 tri-snRNP-associated protein 1
7	9606.ENSP00000323191	0.766	Sarcoma antigen 1
8	9606.ENSP00000338796	0.741	Synovial sarcoma, X breakpoint 2
9	9606.ENSP00000247306	0.720	Belongs to the CTAG/PCC1 family
10	9606.ENSP00000366118	0.703	Protein SSX1
11	9606.ENSP00000470185	0.702	Cancer/testis antigen family 45 member A1
12	9606.ENSP00000469011	0.692	Synovial sarcoma, X breakpoint 4
13	9606.ENSP00000469394	0.691	Protein SSX4
14	9606.ENSP00000355421	0.650	G antigen 2A
15	9606.ENSP00000485185	0.644	Unknown. Candidate gene encoding tumor antigens
16	9606.ENSP00000364766	0.637	X antigen family member 1B
17	9606.ENSP00000364752	0.636	X antigen family member 1A
18	9606.ENSP00000425493	0.611	Cancer-associated gene 1 protein
19	9606.ENSP00000484645	0.611	Nuclear RNA export factor 2B
20	9606.ENSP00000351884	0.609	Sperm protein associated with the nucleus on the X chromosome C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0050794	0.865	regulation of cellular process
GO:0019222	0.567	regulation of metabolic process
GO:0048519	0.503	negative regulation of biological process
GO:0009987	0.443	cellular process
GO:0060255	0.428	regulation of macromolecule metabolic process
GO:0048523	0.412	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0012505	0.504	endomembrane system
GO:0005829	0.499	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]