StarFunc result for job id O60739

User Input

>input (113 residues)
MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV
KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60739	1.000	1.000	1.233E-23	113	1.000	1.000	O60739.pdb.gz	EIF1B_HUMAN Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2
2	AFDB:Q9VZS3	0.883	0.906	1.988E-16	110	0.673	0.691	Q9VZS3.pdb.gz	ETIF1_DROME Eukaryotic translation initiation factor eIF1 OS=Drosophila melanogaster OX=7227 GN=eIF1 PE=1 SV=1
3	PDB:2if1A	0.710	0.641	5.481E-16	126	0.920	0.825	2if1A.pdb.gz
4	AFDB:P41568	0.786	0.786	2.964E-15	113	0.558	0.558	P41568.pdb.gz	SUI11_ARATH Protein translation factor SUI1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27130 PE=1 SV=2
5	AFDB:P32911	0.764	0.801	1.683E-14	108	0.558	0.583	P32911.pdb.gz	SUI1_YEAST Eukaryotic translation initiation factor eIF-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUI1 PE=1 SV=1
6	AFDB:Q9FFT6	0.822	0.829	2.816E-14	112	0.522	0.527	Q9FFT6.pdb.gz	Q9FFT6_ARATH AT5g54940/MBG8_21 OS=Arabidopsis thaliana OX=3702 GN=MBG8.21 PE=1 SV=1
7	AFDB:P79060	0.852	0.881	1.159E-13	109	0.540	0.560	P79060.pdb.gz	SUI1_SCHPO Protein translation factor sui1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sui1 PE=3 SV=3
8	PDB:2oghA	0.629	0.654	4.242E-11	108	0.575	0.602	2oghA.pdb.gz
9	AFDB:Q4QAL1	0.722	0.762	5.225E-11	107	0.327	0.346	Q4QAL1.pdb.gz	Q4QAL1_LEIMA Putative translation factor sui1 OS=Leishmania major OX=5664 GN=LMJF_24_1210 PE=3 SV=1
10	AFDB:Q385I4	0.720	0.745	1.206E-10	109	0.327	0.339	Q385I4.pdb.gz	Q385I4_TRYB2 Protein translation factor SUI1 homolog, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3595 PE=3 SV=1
11	AFDB:Q9VX98	0.669	0.409	1.048E-6	189	0.257	0.153	Q9VX98.pdb.gz	DENR_DROME Density-regulated protein homolog OS=Drosophila melanogaster OX=7227 GN=DENR PE=1 SV=3
12	AFDB:Q04600	0.661	0.141	8.752E-6	565	0.168	0.034	Q04600.pdb.gz	TMA64_YEAST Translation machinery-associated protein 64 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMA64 PE=1 SV=1
13	PDB:5oa30	0.670	0.171	2.444E-4	479	0.177	0.042	5oa30.pdb.gz	Structural and Functional Insights into Human Re-initiation Complexes.
14	PDB:6vpqA	0.508	0.645	3.245E-2	87	0.177	0.230	6vpqA.pdb.gz	Crystal structure of the C-terminal domain of DENR.
15	PDB:3i4mK	0.381	0.373	3.691E-2	116	0.133	0.129	3i4mK.pdb.gz	Molecular basis of transcriptional mutagenesis at 8-oxoguanine
16	PDB:5iy6K	0.345	0.340	3.691E-2	117	0.133	0.128	5iy6K.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
17	PDB:7odrg	0.465	0.403	3.691E-2	134	0.088	0.075	7odrg.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
18	PDB:7vbaK	0.341	0.352	5.790E-2	108	0.115	0.120	7vbaK.pdb.gz	Structure of the human RNA polymerase I elongation complex.
19	PDB:7ok0L	0.295	0.345	1.175E-1	90	0.106	0.133	7ok0L.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
20	PDB:7nadX	0.246	0.271	1.253E-1	98	0.062	0.071	7nadX.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60739	1.55e-80	233	113	1.000	1.000	EIF1B_HUMAN Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2
2	Q6FG85	1.55e-80	233	113	1.000	1.000	Q6FG85_HUMAN Eukaryotic translation initiation factor 1B, isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=GC20 PE=1 SV=1
3	P48024	6.81e-67	198	113	0.920	0.920	EIF1_MOUSE Eukaryotic translation initiation factor 1 OS=Mus musculus OX=10090 GN=Eif1 PE=1 SV=2
4	P41567	8.39e-67	198	113	0.920	0.920	EIF1_HUMAN Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1
5	Q9VZS3	2.45e-51	159	110	0.690	0.709	ETIF1_DROME Eukaryotic translation initiation factor eIF1 OS=Drosophila melanogaster OX=7227 GN=eIF1 PE=1 SV=1
6	P32911	3.67e-43	138	108	0.558	0.583	SUI1_YEAST Eukaryotic translation initiation factor eIF-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUI1 PE=1 SV=1
7	Q94JV4	3.46e-42	136	113	0.549	0.549	SUI12_ARATH Protein translation factor SUI1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At1g54290 PE=3 SV=1
8	P41568	5.92e-42	135	113	0.540	0.540	SUI11_ARATH Protein translation factor SUI1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27130 PE=1 SV=2
9	Q9FFV1	1.11e-41	135	113	0.540	0.540	Q9FFV1_ARATH At5g54760 OS=Arabidopsis thaliana OX=3702 GN=MBG8.2 PE=1 SV=1
10	P79060	3.97e-37	123	109	0.540	0.560	SUI1_SCHPO Protein translation factor sui1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sui1 PE=3 SV=3
11	Q9FFT6	6.10e-37	123	112	0.504	0.509	Q9FFT6_ARATH AT5g54940/MBG8_21 OS=Arabidopsis thaliana OX=3702 GN=MBG8.21 PE=1 SV=1
12	Q4QAL1	4.64e-22	85.1	107	0.327	0.346	Q4QAL1_LEIMA Putative translation factor sui1 OS=Leishmania major OX=5664 GN=LMJF_24_1210 PE=3 SV=1
13	Q385I4	6.22e-22	85.1	109	0.327	0.339	Q385I4_TRYB2 Protein translation factor SUI1 homolog, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3595 PE=3 SV=1
14	P08245	0.026	34.3	108	0.239	0.250	YCIH_ECOLI Uncharacterized protein YciH OS=Escherichia coli (strain K12) OX=83333 GN=yciH PE=1 SV=1
15	Q9VX98	1.8	29.6	189	0.195	0.116	DENR_DROME Density-regulated protein homolog OS=Drosophila melanogaster OX=7227 GN=DENR PE=1 SV=3
16	G5EFY8	2.0	28.9	109	0.150	0.156	G5EFY8_CAEEL Insulin-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ins-1 PE=2 SV=1
17	Q92887	2.1	29.6	1545	0.133	0.010	MRP2_HUMAN ATP-binding cassette sub-family C member 2 OS=Homo sapiens OX=9606 GN=ABCC2 PE=1 SV=3
18	Q90WG6	9.8	27.7	432	0.150	0.039	NEUA_ONCMY N-acylneuraminate cytidylyltransferase OS=Oncorhynchus mykiss OX=8022 GN=cmas PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01253 SUI1	2.1e-26	103.5	Translation initiation factor SUI1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008847653.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008822158.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 mRNAs, 3 ESTs, 17 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
2	1026970.XP_008848290.1	0.990	Eukaryotic translation initiation factor 3 subunit G
3	1026970.XP_008825541.1	0.988	Eukaryotic translation initiation factor 3 subunit A
4	1026970.XP_008846216.1	0.986	Eukaryotic translation initiation factor 3 subunit I
5	1026970.XP_008849626.1	0.986	Eukaryotic translation initiation factor 3 subunit B
6	1026970.XP_008823485.1	0.982	Eukaryotic translation initiation factor 1A
7	1026970.XP_008833942.1	0.982	Eukaryotic translation initiation factor 1A, X-linked
8	1026970.XP_008847362.1	0.977	Eukaryotic translation initiation factor 3 subunit J
9	1026970.XP_008850369.1	0.976	Eukaryotic translation initiation factor 2 subunit 1
10	1026970.XP_008836181.1	0.969	Eukaryotic translation initiation factor 3 subunit H
11	1026970.XP_008853271.1	0.967	Eukaryotic translation initiation factor 2 subunit beta
12	1026970.XP_008820936.1	0.962	Eukaryotic translation initiation factor 2 subunit gamma
13	1026970.XP_008844086.1	0.962	Eukaryotic translation initiation factor 5B
14	1026970.XP_008823795.1	0.955	Eukaryotic translation initiation factor 5
15	1026970.XP_008849559.1	0.929	Eukaryotic translation initiation factor 3 subunit D
16	1026970.XP_008849727.1	0.929	Eukaryotic translation initiation factor 3 subunit E
17	1026970.XP_008851651.1	0.927	Eukaryotic translation initiation factor 3 subunit F
18	1026970.XP_008825705.1	0.888	ATP-binding cassette sub-family E member 1
19	1026970.XP_008829510.1	0.885	Eukaryotic translation initiation factor 4 gamma 1 isoform X1
20	1026970.XP_008833467.1	0.880	Eukaryotic translation initiation factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0045182	0.305	translation regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.992	regulation of gene expression
GO:0009987	0.988	cellular process
GO:0050794	0.920	regulation of cellular process
GO:0034248	0.885	regulation of amide metabolic process
GO:2000112	0.836	regulation of cellular macromolecule biosynthetic process
GO:0010608	0.824	post-transcriptional regulation of gene expression
GO:0080090	0.798	regulation of primary metabolic process
GO:0006446	0.775	regulation of translational initiation
GO:0071840	0.666	cellular component organization or biogenesis
GO:0016043	0.527	cellular component organization
GO:0040029	0.446	epigenetic regulation of gene expression
GO:0007549	0.413	dosage compensation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.982	nucleus
GO:0005829	0.921	cytosol
GO:0032991	0.337	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]