StarFunc result for job id O60741

User Input

>input (890 residues)
MEGGGKPNSSSNSRDDGNSVFPAKASATGAGPAAAEKRLGTPPGGGGAGAKEHGNSVCFK
VDGGGGGGGGGGGGEEPAGGFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAV
EKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNV
ASDTVFLLDLIMNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVE
KGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFN
LIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIG
YGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANAD
PNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGE
ICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSI
LLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIAPINYPQMTTLNSTSSTTTPTSRM
RTQSPPVYTATSLSHSNLHSPSPSTQTPQPSAILSPCSYTTAVCSPPVQSPLAARTFHYA
SPTASQLSLMQQQPQQQVQQSQPPQTQPQQPSPQPQTPGSSTPKNEVHKSTQALHNTNLT
REVRPLSASQPSLPHEVSTLISRPHPTVGESLASIPQPVTAVPGTGLQAGGRSTVPQRVT
LFRQMSSGAIPPNRGVPPAPPPPAAALPRESSSVLNTDPDAEKPRFASNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60741	1.000	1.000	0.000	890	1.000	1.000	O60741.pdb.gz	HCN1_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Homo sapiens OX=9606 GN=HCN1 PE=1 SV=3
2	AFDB:A0A0R4IRW0	0.646	0.634	2.425E-86	908	0.735	0.720	A0A0R4IRW0.pdb.gz	A0A0R4IRW0_DANRE Hyperpolarization-activated cyclic nucleotide-gated potassium channel 1 OS=Danio rerio OX=7955 GN=LOC100334297 PE=3 SV=1
3	AFDB:Q9UQ05	0.394	0.352	6.548E-26	1017	0.217	0.190	Q9UQ05.pdb.gz	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
4	PDB:7rhsA	0.380	0.659	3.749E-23	456	0.136	0.265	7rhsA.pdb.gz
5	PDB:7n15A	0.377	0.588	1.065E-20	520	0.125	0.213	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
6	PDB:7wswA	0.386	0.657	5.285E-20	472	0.103	0.195	7wswA.pdb.gz
7	PDB:7o4hB	0.371	0.636	2.770E-18	468	0.139	0.265	7o4hB.pdb.gz
8	PDB:7rhsD	0.334	0.580	3.617E-18	441	0.115	0.231	7rhsD.pdb.gz
9	PDB:7xufA	0.349	0.582	5.644E-18	476	0.106	0.197	7xufA.pdb.gz
10	PDB:7calA	0.406	0.761	1.961E-17	444	0.096	0.191	7calA.pdb.gz
11	PDB:7o4hD	0.294	0.607	9.091E-15	383	0.104	0.243	7o4hD.pdb.gz
12	PDB:6eo1A	0.139	0.310	1.974E-8	355	0.078	0.194	6eo1A.pdb.gz
13	PDB:4ev0D	0.115	0.452	6.277E-8	214	0.043	0.178	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
14	AFDB:Q92953	0.135	0.133	5.795E-4	911	0.122	0.120	Q92953.pdb.gz	KCNB2_HUMAN Potassium voltage-gated channel subfamily B member 2 OS=Homo sapiens OX=9606 GN=KCNB2 PE=1 SV=2
15	AFDB:Q9HCF6	0.126	0.083	1.947E-2	1732	0.118	0.061	Q9HCF6.pdb.gz	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
16	AFDB:X1WD79	0.067	0.055	2.035E-2	1138	0.126	0.098	X1WD79.pdb.gz	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
17	AFDB:P39016	0.079	0.081	3.471E-2	859	0.126	0.130	P39016.pdb.gz	MPT5_YEAST Suppressor protein MPT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MPT5 PE=1 SV=2
18	AFDB:D3ZEY0	0.079	0.056	4.739E-2	1530	0.117	0.068	D3ZEY0.pdb.gz	CC141_RAT Coiled-coil domain-containing protein 141 OS=Rattus norvegicus OX=10116 GN=Ccdc141 PE=1 SV=2
19	AFDB:Q86YF9	0.056	0.057	5.416E-2	867	0.118	0.121	Q86YF9.pdb.gz	DZIP1_HUMAN Cilium assembly protein DZIP1 OS=Homo sapiens OX=9606 GN=DZIP1 PE=1 SV=1
20	AFDB:P40450	0.083	0.064	9.236E-2	1375	0.140	0.091	P40450.pdb.gz	BNR1_YEAST BNI1-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNR1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IRW0	1262	908	0.748	0.733	A0A0R4IRW0_DANRE Hyperpolarization-activated cyclic nucleotide-gated potassium channel 1 OS=Danio rerio OX=7955 GN=LOC100334297 PE=3 SV=1
2	A1Z9N7	654	1327	0.351	0.235	A1Z9N7_DROME I[[h]] channel, isoform E OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
3	A1Z9N8	667	1290	0.347	0.240	A1Z9N8_DROME I[[h]] channel, isoform B OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
4	A1Z9P0	654	601	0.349	0.517	A1Z9P0_DROME I[[h]] channel, isoform I OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
5	B7YZE7	666	1295	0.351	0.241	B7YZE7_DROME I[[h]] channel, isoform F OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
6	B7YZE8	655	1322	0.347	0.234	B7YZE8_DROME I[[h]] channel, isoform G OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
7	O60741	1857	890	1.000	1.000	HCN1_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Homo sapiens OX=9606 GN=HCN1 PE=1 SV=3
8	O70507	959	1186	0.527	0.395	HCN4_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Mus musculus OX=10090 GN=Hcn4 PE=1 SV=2
9	O88703	977	863	0.520	0.537	HCN2_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Mus musculus OX=10090 GN=Hcn2 PE=1 SV=1
10	O88704	1387	910	0.785	0.768	HCN1_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Mus musculus OX=10090 GN=Hcn1 PE=1 SV=1
11	O88705	889	779	0.529	0.605	HCN3_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Mus musculus OX=10090 GN=Hcn3 PE=1 SV=1
12	Q56JH7	654	1319	0.351	0.237	Q56JH7_DROME Hyperpolarization-activated ion channel variant DMIH-A1B2C2 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
13	Q56JH8	654	627	0.347	0.493	Q56JH8_DROME Hyperpolarization-activated ion channel variant DMIH-A3B1C1 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
14	Q56JH9	654	618	0.347	0.500	Q56JH9_DROME Hyperpolarization-activated ion channel variant DMIH-A2B1C1 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
15	Q56JI0	667	1282	0.347	0.241	Q56JI0_DROME Hyperpolarization-activated ion channel variant DMIH-A1B1C1 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
16	Q9JKA7	1003	1198	0.546	0.406	HCN4_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Rattus norvegicus OX=10116 GN=Hcn4 PE=1 SV=1
17	Q9JKA8	880	780	0.529	0.604	HCN3_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Rattus norvegicus OX=10116 GN=Hcn3 PE=1 SV=1
18	Q9JKA9	976	863	0.520	0.537	HCN2_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Rattus norvegicus OX=10116 GN=Hcn2 PE=1 SV=3
19	Q9JKB0	1399	910	0.791	0.774	HCN1_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Rattus norvegicus OX=10116 GN=Hcn1 PE=2 SV=1
20	Q9P1Z3	860	774	0.521	0.599	HCN3_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Homo sapiens OX=9606 GN=HCN3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	4.7e-14	63.6	Cyclic nucleotide-binding domain
2	PF03564 DUF1759	3.4e+02	12.6	Protein of unknown function (DUF1759)
3	PF00520 Ion_trans	1.4e-17	75.4	Ion transport protein
4	PF07885 Ion_trans_2	1.9e+02	13.4	Ion channel
5	PF08412 Ion_trans_N	3.6e-18	76.2	Ion transport protein N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307342

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251287	0.946	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
2	9606.ENSP00000419975	0.896	PEX5-related protein
3	9606.ENSP00000357342	0.864	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
4	9606.ENSP00000261917	0.819	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
5	9606.ENSP00000381339	0.650	Guanine nucleotide-binding protein G(t) subunit alpha-3
6	9606.ENSP00000424328	0.621	Mitochondrial ribosomal protein S30
7	9606.ENSP00000389445	0.553	Ubiquitin-associated protein 2-like
8	9606.ENSP00000482358	0.540	Serine protease 57
9	9606.ENSP00000279147	0.538	The complex LTO1:YAE1 functions as a target specific adapter that probably recruits apo-ABCE1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery . May be required for biogenesis of the large ribosomal subunit and initiation of translation . May play a role in the regulation of proline metabolism and ROS production .

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030552	1.000	cAMP binding
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0005248	0.999	voltage-gated sodium channel activity
GO:0042802	0.996	identical protein binding
GO:0005221	0.996	intracellular cyclic nucleotide activated monoatomic cation channel activity
GO:0044877	0.990	protein-containing complex binding
GO:0008289	0.359	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0065007	0.990	biological regulation
GO:0042391	0.971	regulation of membrane potential
GO:0050896	0.969	response to stimulus
GO:0050789	0.969	regulation of biological process
GO:0032501	0.966	multicellular organismal process
GO:0006811	0.957	monoatomic ion transport
GO:0051591	0.949	response to cAMP
GO:0006812	0.937	monoatomic cation transport
GO:0050794	0.926	regulation of cellular process
GO:0071417	0.917	cellular response to organonitrogen compound
GO:0071320	0.886	cellular response to cAMP
GO:0071805	0.881	potassium ion transmembrane transport
GO:0003254	0.859	regulation of membrane depolarization
GO:0006814	0.806	sodium ion transport
GO:0035725	0.539	sodium ion transmembrane transport
GO:0007154	0.467	cell communication
GO:0032502	0.436	developmental process
GO:0023052	0.409	signaling
GO:0071840	0.378	cellular component organization or biogenesis
GO:0016043	0.317	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.998	protein-containing complex
GO:0008076	0.987	voltage-gated potassium channel complex
GO:0005737	0.977	cytoplasm
GO:0030054	0.535	cell junction
GO:0042995	0.479	cell projection
GO:0045202	0.400	synapse
GO:0120025	0.389	plasma membrane bounded cell projection
GO:0098855	0.381	HCN channel complex
GO:0043005	0.371	neuron projection
GO:0098590	0.362	plasma membrane region
GO:0030424	0.329	axon
GO:0098793	0.319	presynapse
GO:0030425	0.312	dendrite
GO:0043227	0.301	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)
RHEA:34963	0.999	Na(+)(in) = Na(+)(out)

[back to server]