StarFunc result for job id O60755

User Input

>input (368 residues)
MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF
ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR
YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG
GEAARGPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88626	0.844	0.840	2.979E-41	370	0.897	0.892	O88626.pdb.gz	GALR3_RAT Galanin receptor type 3 OS=Rattus norvegicus OX=10116 GN=Galr3 PE=2 SV=1
2	AFDB:O08726	0.733	0.725	1.881E-27	372	0.541	0.535	O08726.pdb.gz	GALR2_RAT Galanin receptor type 2 OS=Rattus norvegicus OX=10116 GN=Galr2 PE=2 SV=1
3	AFDB:F1R332	0.741	0.751	1.046E-26	363	0.448	0.455	F1R332.pdb.gz	GAL2A_DANRE Galanin receptor 2a OS=Danio rerio OX=7955 GN=galr2a PE=2 SV=2
4	AFDB:O43603	0.733	0.698	1.091E-26	387	0.560	0.532	O43603.pdb.gz	GALR2_HUMAN Galanin receptor type 2 OS=Homo sapiens OX=9606 GN=GALR2 PE=1 SV=1
5	AFDB:B3GRU6	0.761	0.757	4.690E-26	370	0.492	0.489	B3GRU6.pdb.gz	B3GRU6_CHICK Galanin receptor 2-like protein OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:E7F7V7	0.753	0.734	4.896E-26	378	0.457	0.444	E7F7V7.pdb.gz	GAL2B_DANRE Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr2b PE=2 SV=1
7	PDB:7wq4R	0.702	0.906	3.155E-24	282	0.508	0.663	7wq4R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
8	AFDB:P47211	0.752	0.791	7.271E-22	349	0.321	0.338	P47211.pdb.gz	GALR1_HUMAN Galanin receptor type 1 OS=Homo sapiens OX=9606 GN=GALR1 PE=1 SV=3
9	AFDB:F1QF39	0.742	0.778	8.269E-22	350	0.312	0.329	F1QF39.pdb.gz	F1QF39_DANRE Galanin receptor 1b OS=Danio rerio OX=7955 GN=galr1b PE=3 SV=1
10	AFDB:F1QSA8	0.754	0.797	1.573E-21	347	0.315	0.334	F1QSA8.pdb.gz	F1QSA8_DANRE Galanin receptor 1a OS=Danio rerio OX=7955 GN=galr1a PE=3 SV=2
11	AFDB:A0A2R8QGJ3	0.678	0.764	1.098E-19	325	0.312	0.354	A0A2R8QGJ3.pdb.gz
12	PDB:7wq3R	0.709	0.891	4.357E-19	289	0.307	0.391	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
13	PDB:8ef5M	0.689	0.867	1.866E-15	288	0.220	0.281	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
14	PDB:7wicR	0.693	0.873	3.401E-15	288	0.220	0.281	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
15	PDB:7w55R	0.676	0.810	2.781E-14	303	0.234	0.284	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
16	PDB:7vl9R	0.675	0.813	3.919E-14	302	0.212	0.258	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
17	PDB:4dklA	0.680	0.569	1.051E-13	442	0.226	0.188	4dklA.pdb.gz	Crystal structure of the {mu}-opioid receptor bound to a morphinan antagonist.
18	PDB:7mbyR	0.657	0.841	1.684E-13	283	0.217	0.283	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
19	PDB:7f1qR	0.639	0.641	5.596E-13	367	0.193	0.193	7f1qR.pdb.gz
20	PDB:4xesA	0.663	0.527	7.238E-13	471	0.207	0.161	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60755	0.0	719	368	1.000	1.000	GALR3_HUMAN Galanin receptor type 3 OS=Homo sapiens OX=9606 GN=GALR3 PE=1 SV=1
2	O88626	0.0	557	370	0.894	0.889	GALR3_RAT Galanin receptor type 3 OS=Rattus norvegicus OX=10116 GN=Galr3 PE=2 SV=1
3	O88853	0.0	564	370	0.905	0.900	GALR3_MOUSE Galanin receptor type 3 OS=Mus musculus OX=10090 GN=Galr3 PE=2 SV=2
4	O08726	1.42e-126	370	372	0.543	0.538	GALR2_RAT Galanin receptor type 2 OS=Rattus norvegicus OX=10116 GN=Galr2 PE=2 SV=1
5	O88854	3.00e-125	367	371	0.519	0.515	GALR2_MOUSE Galanin receptor type 2 OS=Mus musculus OX=10090 GN=Galr2 PE=2 SV=2
6	O43603	6.50e-125	366	387	0.508	0.483	GALR2_HUMAN Galanin receptor type 2 OS=Homo sapiens OX=9606 GN=GALR2 PE=1 SV=1
7	B3GRU6	1.48e-123	362	370	0.473	0.470	B3GRU6_CHICK Galanin receptor 2-like protein OS=Gallus gallus OX=9031 PE=2 SV=1
8	F1R332	9.40e-123	360	363	0.481	0.488	GAL2A_DANRE Galanin receptor 2a OS=Danio rerio OX=7955 GN=galr2a PE=2 SV=2
9	E7F7V7	3.33e-120	354	378	0.451	0.439	GAL2B_DANRE Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr2b PE=2 SV=1
10	F1QF39	1.23e-68	221	350	0.312	0.329	F1QF39_DANRE Galanin receptor 1b OS=Danio rerio OX=7955 GN=galr1b PE=3 SV=1
11	F1QSA8	2.22e-63	207	347	0.312	0.331	F1QSA8_DANRE Galanin receptor 1a OS=Danio rerio OX=7955 GN=galr1a PE=3 SV=2
12	P47211	4.05e-61	202	349	0.321	0.338	GALR1_HUMAN Galanin receptor type 1 OS=Homo sapiens OX=9606 GN=GALR1 PE=1 SV=3
13	Q62805	1.99e-59	197	346	0.304	0.324	GALR1_RAT Galanin receptor type 1 OS=Rattus norvegicus OX=10116 GN=Galr1 PE=2 SV=1
14	P56479	8.25e-59	196	348	0.302	0.319	GALR1_MOUSE Galanin receptor type 1 OS=Mus musculus OX=10090 GN=Galr1 PE=2 SV=1
15	Q8WPA2	3.53e-52	179	361	0.291	0.296	AR_BOMMO Allatostatin-A receptor OS=Bombyx mori OX=7091 GN=AR PE=2 SV=1
16	F1R5R4	5.20e-49	171	366	0.291	0.292	F1R5R4_DANRE KISS1 receptor a OS=Danio rerio OX=7955 GN=kissr2 PE=2 SV=1
17	Q9U721	6.34e-49	171	394	0.293	0.274	Q9U721_DROME Allatostatin A receptor 1, isoform B OS=Drosophila melanogaster OX=7227 GN=AstA-R1 PE=2 SV=1
18	F1QZU4	1.05e-45	162	364	0.277	0.280	F1QZU4_DANRE KISS1 receptor b OS=Danio rerio OX=7955 GN=si:ch211-157p22.8 PE=4 SV=1
19	A8CAH4	1.08e-45	162	364	0.277	0.280	A8CAH4_DANRE G protein-coupled receptor 54-2 OS=Danio rerio OX=7955 GN=si:ch211-157p22.8 PE=2 SV=1
20	Q91V45	1.35e-45	162	396	0.345	0.321	KISSR_MOUSE KiSS-1 receptor OS=Mus musculus OX=10090 GN=Kiss1r PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	2.6e-44	163.1	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.00093	30.6	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	1.6e+02	13.1	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10323 7TM_GPCR_Srv	25	15.7	Serpentine type 7TM GPCR chemoreceptor Srv
5	PF10324 7TM_GPCR_Srw	1.2e+02	13.4	Serpentine type 7TM GPCR chemoreceptor Srw
6	PF10328 7TM_GPCR_Srx	35	15.4	Serpentine type 7TM GPCR chemoreceptor Srx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249041

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265643	0.997	Galanin peptides
2	9606.ENSP00000371110	0.909	2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial
3	9606.ENSP00000299727	0.825	Galanin receptor type 1
4	9606.ENSP00000329684	0.810	Galanin receptor type 2
5	9606.ENSP00000349884	0.732	Galanin-like peptide
6	9606.ENSP00000256969	0.650	Spexin
7	9606.ENSP00000311833	0.553	Glucose-6-phosphate exchanger SLC37A2
8	9606.ENSP00000344504	0.520	Histone H1.0

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008188	1.000	neuropeptide receptor activity
GO:0005488	0.996	binding
GO:0005515	0.971	protein binding
GO:0042562	0.303	hormone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0023052	0.997	signaling
GO:0007154	0.997	cell communication
GO:0051716	0.996	cellular response to stimulus
GO:0007186	0.989	G protein-coupled receptor signaling pathway
GO:0007218	0.898	neuropeptide signaling pathway
GO:0048518	0.567	positive regulation of biological process
GO:0019222	0.553	regulation of metabolic process
GO:0048522	0.530	positive regulation of cellular process
GO:0060255	0.521	regulation of macromolecule metabolic process
GO:0031323	0.456	regulation of cellular metabolic process
GO:0051171	0.453	regulation of nitrogen compound metabolic process
GO:0080090	0.450	regulation of primary metabolic process
GO:0009893	0.429	positive regulation of metabolic process
GO:0019219	0.427	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.425	regulation of gene expression
GO:0010604	0.421	positive regulation of macromolecule metabolic process
GO:0031325	0.416	positive regulation of cellular metabolic process
GO:0051173	0.406	positive regulation of nitrogen compound metabolic process
GO:0045935	0.396	positive regulation of nucleobase-containing compound metabolic process
GO:0051252	0.327	regulation of RNA metabolic process
GO:0031326	0.321	regulation of cellular biosynthetic process
GO:0045893	0.306	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0071944	0.998	cell periphery
GO:0016020	0.998	membrane
GO:0005886	0.989	plasma membrane
GO:0120025	0.987	plasma membrane bounded cell projection
GO:0005929	0.984	cilium
GO:0043229	0.678	intracellular organelle
GO:0043231	0.335	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]