StarFunc result for job id O60759

User Input

>input (359 residues)
MSLQRLLQHSSNGNLADFCAGPAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLA
LTRSSSLSDFSWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPA
HCAGLQAGDVLANINGVSTEGFTYKQVVDLIRSSGNLLTIETLNGTMILKRTELEAKLQV
LKQTLKQKWVEYRSLQLQEHRLLHGDAANCPSLENMDLDELSLFGPLPGPGPALVDRNRL
SSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTSTDDECFIPKEGDDFLRRSSSR
RNRSISNTSSGSMSPLWEGNLSSMFGTLPRKSRKGSVRKQLLKFIPGLHRAVEEEESRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60759	1.000	1.000	3.990E-58	359	1.000	1.000	O60759.pdb.gz	CYTIP_HUMAN Cytohesin-interacting protein OS=Homo sapiens OX=9606 GN=CYTIP PE=1 SV=2
2	AFDB:Q9UPX8	0.222	0.057	6.832E-8	1470	0.139	0.034	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
3	AFDB:Q5VSD9	0.235	0.070	6.295E-7	1274	0.162	0.046	Q5VSD9.pdb.gz
4	AFDB:Q9W283	0.240	0.071	2.299E-6	1329	0.142	0.038	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
5	PDB:7pcbA	0.222	0.193	3.603E-6	415	0.070	0.060	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
6	AFDB:A1Z9K8	0.228	0.046	4.821E-6	1871	0.184	0.035	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
7	AFDB:F1Q897	0.228	0.057	6.563E-6	1503	0.145	0.035	F1Q897.pdb.gz	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
8	AFDB:B9EJ80	0.226	0.077	6.980E-6	1147	0.136	0.043	B9EJ80.pdb.gz	PDZD8_MOUSE PDZ domain-containing protein 8 OS=Mus musculus OX=10090 GN=Pdzd8 PE=1 SV=1
9	AFDB:Q14005	0.252	0.076	7.424E-6	1332	0.142	0.038	Q14005.pdb.gz	IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens OX=9606 GN=IL16 PE=1 SV=4
10	AFDB:O54824	0.249	0.077	1.556E-5	1322	0.173	0.047	O54824.pdb.gz	IL16_MOUSE Pro-interleukin-16 OS=Mus musculus OX=10090 GN=Il16 PE=1 SV=3
11	PDB:7p73A	0.211	0.182	2.594E-5	420	0.056	0.048	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
12	AFDB:Q96QZ7	0.218	0.060	3.692E-5	1491	0.170	0.041	Q96QZ7.pdb.gz	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
13	PDB:7pc3A	0.217	0.194	6.961E-5	405	0.056	0.049	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:5n7dA	0.214	0.182	1.072E-4	423	0.058	0.050	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
15	PDB:6t36A	0.222	0.802	1.372E-4	93	0.067	0.258	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
16	PDB:7p70A	0.216	0.191	1.552E-4	407	0.061	0.054	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:7qqmA	0.209	0.183	1.987E-4	413	0.064	0.056	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:2xkxA	0.216	0.110	2.113E-4	721	0.056	0.028	2xkxA.pdb.gz
19	PDB:7qqnC	0.208	0.182	2.248E-4	414	0.058	0.051	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pe9I	0.221	0.249	3.060E-4	317	0.058	0.066	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60759	0.0	739	359	1.000	1.000	CYTIP_HUMAN Cytohesin-interacting protein OS=Homo sapiens OX=9606 GN=CYTIP PE=1 SV=2
2	Q8R4T5	2.41e-54	185	394	0.351	0.320	GRASP_RAT General receptor for phosphoinositides 1-associated scaffold protein OS=Rattus norvegicus OX=10116 GN=Tamalin PE=1 SV=1
3	Q9JJA9	6.29e-54	184	392	0.351	0.321	GRASP_MOUSE General receptor for phosphoinositides 1-associated scaffold protein OS=Mus musculus OX=10090 GN=Tamalin PE=1 SV=2
4	Q9P227	1.13e-08	59.3	1491	0.100	0.024	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
5	Q865P3	8.19e-08	56.2	518	0.086	0.060	NHRF3_RABIT Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Oryctolagus cuniculus OX=9986 GN=PDZK1 PE=1 SV=1
6	Q5T2W1	1.82e-07	55.1	519	0.097	0.067	NHRF3_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Homo sapiens OX=9606 GN=PDZK1 PE=1 SV=2
7	Q9R1L5	2.27e-07	55.1	1570	0.070	0.016	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
8	Q9JJ40	2.93e-07	54.3	523	0.086	0.059	NHRF3_RAT Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Rattus norvegicus OX=10116 GN=Pdzk1 PE=1 SV=2
9	Q9Y2H9	2.95e-07	54.7	1570	0.070	0.016	MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MAST1 PE=1 SV=2
10	Q9JIL4	4.43e-07	53.9	519	0.097	0.067	NHRF3_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Mus musculus OX=10090 GN=Pdzk1 PE=1 SV=1
11	A0A087WT53	7.51e-07	53.5	1155	0.095	0.029	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
12	O60307	1.04e-06	53.1	1309	0.067	0.018	MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=MAST3 PE=1 SV=2
13	A0A8I3NPD4	1.14e-06	53.1	1398	0.095	0.024	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1
14	Q96QZ7	1.22e-06	52.8	1491	0.095	0.023	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
15	A0A087WXD2	1.52e-06	52.4	980	0.095	0.035	A0A087WXD2_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
16	H7C535	1.66e-06	52.4	1136	0.095	0.030	H7C535_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
17	H7C4U7	2.20e-06	52.0	1131	0.095	0.030	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
18	H7C5T8	2.33e-06	52.0	1014	0.095	0.034	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
19	Q6P0Q8	2.42e-06	52.0	1798	0.067	0.013	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
20	Q6RHR9	4.47e-06	51.2	1471	0.198	0.048	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	4.3e+02	11.4	Family of unknown function (DUF6288)
2	PF00595 PDZ	7.1e-11	53.6	PDZ domain
3	PF13180 PDZ_2	21	16.9	PDZ domain
4	PF17820 PDZ_6	3.8e-07	41.2	PDZ domain
5	PF02163 Peptidase_M50	3.2	18.5	Peptidase family M50
6	PF08119 Toxin_31	3e+02	12.6	Scorpion acidic alpha-KTx toxin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264192

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354398	0.965	Cytohesin-1
2	9606.ENSP00000297044	0.844	Cytohesin-3
3	9606.ENSP00000357836	0.781	Sorting nexin-27
4	9606.ENSP00000283752	0.744	Serpin B3
5	9606.ENSP00000356842	0.742	Cell surface A33 antigen
6	9606.ENSP00000412178	0.738	Diacylglycerol kinase zeta
7	9606.ENSP00000411355	0.714	Receptor-type tyrosine-protein phosphatase C
8	9606.ENSP00000355991	0.699	TRAF3-interacting JNK-activating modulator
9	9606.ENSP00000258770	0.686	Protein TBRG4
10	9606.ENSP00000046794	0.682	Lymphocyte cytosolic protein 2
11	9606.ENSP00000271324	0.677	Leukocyte surface antigen CD53
12	9606.ENSP00000333779	0.676	Protein EVI2B
13	9606.ENSP00000376544	0.671	B-cell antigen receptor complex-associated protein beta chain
14	9606.ENSP00000484431	0.657	CD48 antigen
15	9606.ENSP00000365596	0.655	G-protein coupled receptor 183
16	9606.ENSP00000264972	0.628	Tyrosine-protein kinase ZAP-70
17	9606.ENSP00000354782	0.616	T-cell surface glycoprotein CD3 zeta chain
18	9606.ENSP00000398655	0.613	Tyrosine-protein kinase ITK/TSK
19	9606.ENSP00000276689	0.610	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
20	9606.ENSP00000234313	0.602	Pleckstrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0030155	0.926	regulation of cell adhesion
GO:0009987	0.815	cellular process
GO:0050896	0.551	response to stimulus
GO:0051716	0.315	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0005634	0.993	nucleus
GO:0005829	0.992	cytosol
GO:0005886	0.966	plasma membrane
GO:0031981	0.928	nuclear lumen
GO:0005654	0.919	nucleoplasm
GO:0005938	0.723	cell cortex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]