StarFunc result for job id O60762

User Input

>input (260 residues)
MASLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEI
IIIDDGSPDGTRDVAEQLEKIYGSDRILLRPREKKLGLGTAYIHGMKHATGNYIIIMDAD
LSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFLTQILLRPGA
SDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESK
LGGNEIVSFLKGLLTLFATT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A8N1	0.923	0.923	2.041E-51	260	0.912	0.912	D4A8N1.pdb.gz	D4A8N1_RAT Dolichol-phosphate mannosyltransferase subunit 1 OS=Rattus norvegicus OX=10116 GN=Dpm1 PE=3 SV=1
2	AFDB:Q6DEJ9	0.918	0.953	4.042E-47	250	0.800	0.832	Q6DEJ9.pdb.gz	Q6DEJ9_DANRE Dolichol-phosphate mannosyltransferase subunit 1 OS=Danio rerio OX=7955 GN=zgc:101018 PE=1 SV=1
3	AFDB:Q9LM93	0.900	0.951	3.223E-40	246	0.596	0.630	Q9LM93.pdb.gz	DPM1_ARATH Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=DPMS1 PE=1 SV=1
4	AFDB:A0A1D8PEA2	0.902	0.980	5.894E-39	239	0.581	0.632	A0A1D8PEA2.pdb.gz	A0A1D8PEA2_CANAL Dolichol-phosphate mannosyltransferase subunit 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DPM1 PE=3 SV=1
5	AFDB:O14466	0.869	0.955	3.329E-38	236	0.596	0.657	O14466.pdb.gz	DPM1_SCHPO Dolichol-phosphate mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dpm1 PE=2 SV=1
6	AFDB:Q8IHU9	0.890	0.893	7.222E-36	259	0.481	0.483	Q8IHU9.pdb.gz	Q8IHU9_PLAF7 Dolichol-phosphate mannosyltransferase subunit 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1141600 PE=3 SV=1
7	AFDB:O53493	0.831	0.257	1.352E-23	874	0.315	0.094	O53493.pdb.gz	PPMNT_MYCTU Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppm1 PE=1 SV=1
8	AFDB:Q8U4M3	0.785	0.587	1.313E-21	352	0.342	0.253	Q8U4M3.pdb.gz	DPM1_PYRFU Dolichol-phosphate mannosyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF0058 PE=1 SV=1
9	PDB:5mlzA	0.770	0.573	7.560E-21	355	0.342	0.251	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
10	AFDB:Q4Q256	0.803	0.797	6.870E-20	262	0.296	0.294	Q4Q256.pdb.gz	Q4Q256_LEIMA Dolichol-phosphate mannosyltransferase subunit 1 OS=Leishmania major OX=5664 GN=DPMS PE=3 SV=1
11	AFDB:Q38BE0	0.790	0.793	4.672E-19	259	0.292	0.293	Q38BE0.pdb.gz	Q38BE0_TRYB2 Dolichol-phosphate mannosyltransferase subunit 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2610 PE=3 SV=1
12	PDB:4decA	0.637	0.589	2.281E-11	284	0.192	0.176	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
13	PDB:2bo6A	0.615	0.442	3.686E-10	380	0.173	0.118	2bo6A.pdb.gz	Structural Dissection and High-Throughput Screening of Mannosylglyceerate Synthase
14	PDB:4d0tA	0.583	0.328	1.089E-7	496	0.188	0.099	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
15	PDB:3foqA	0.500	0.314	2.754E-7	439	0.096	0.057	3foqA.pdb.gz	Structure of N-acetylglucosamine-1-phosphate uridyltransferase (GlmU) from Mycobacterium tuberculosis in a cubic space group.
16	PDB:4d11C	0.545	0.342	2.754E-7	436	0.196	0.117	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
17	PDB:4hg6A	0.544	0.216	3.752E-7	747	0.123	0.043	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
18	PDB:3d8vA	0.500	0.291	4.246E-7	478	0.104	0.056	3d8vA.pdb.gz	Structure and function of GlmU from Mycobacterium tuberculosis.
19	PDB:6iwqA	0.505	0.265	5.111E-7	546	0.158	0.075	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
20	PDB:6pxuB	0.565	0.304	7.880E-7	532	0.173	0.085	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60762	0.0	528	260	1.000	1.000	DPM1_HUMAN Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=DPM1 PE=1 SV=1
2	D4A8N1	2.06e-175	485	260	0.912	0.912	D4A8N1_RAT Dolichol-phosphate mannosyltransferase subunit 1 OS=Rattus norvegicus OX=10116 GN=Dpm1 PE=3 SV=1
3	O70152	2.46e-174	482	260	0.912	0.912	DPM1_MOUSE Dolichol-phosphate mannosyltransferase subunit 1 OS=Mus musculus OX=10090 GN=Dpm1 PE=1 SV=1
4	A0A8I6A008	6.99e-168	466	260	0.881	0.881	A0A8I6A008_RAT Dolichol-phosphate mannosyltransferase subunit 1 OS=Rattus norvegicus OX=10116 GN=Dpm1 PE=1 SV=1
5	Q6DEJ9	2.41e-157	439	250	0.800	0.832	Q6DEJ9_DANRE Dolichol-phosphate mannosyltransferase subunit 1 OS=Danio rerio OX=7955 GN=zgc:101018 PE=1 SV=1
6	A0A8I6GKW5	5.48e-146	408	208	0.754	0.942	A0A8I6GKW5_RAT Dolichol-phosphate mannosyltransferase subunit 1 OS=Rattus norvegicus OX=10116 GN=Dpm1 PE=1 SV=1
7	A0A1D8PEA2	1.94e-118	340	239	0.581	0.632	A0A1D8PEA2_CANAL Dolichol-phosphate mannosyltransferase subunit 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DPM1 PE=3 SV=1
8	O14466	4.06e-118	339	236	0.596	0.657	DPM1_SCHPO Dolichol-phosphate mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dpm1 PE=2 SV=1
9	Q9LM93	8.31e-117	336	246	0.596	0.630	DPM1_ARATH Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=DPMS1 PE=1 SV=1
10	Q8IHU9	1.36e-89	268	259	0.481	0.483	Q8IHU9_PLAF7 Dolichol-phosphate mannosyltransferase subunit 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1141600 PE=3 SV=1
11	Q8U4M3	4.38e-37	135	352	0.354	0.261	DPM1_PYRFU Dolichol-phosphate mannosyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF0058 PE=1 SV=1
12	O53493	1.61e-34	133	874	0.292	0.087	PPMNT_MYCTU Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppm1 PE=1 SV=1
13	Q4Q256	5.38e-33	122	262	0.300	0.298	Q4Q256_LEIMA Dolichol-phosphate mannosyltransferase subunit 1 OS=Leishmania major OX=5664 GN=DPMS PE=3 SV=1
14	Q38BE0	3.67e-32	120	259	0.308	0.309	Q38BE0_TRYB2 Dolichol-phosphate mannosyltransferase subunit 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2610 PE=3 SV=1
15	P14020	3.95e-29	112	267	0.300	0.292	DPM1_YEAST Dolichol-phosphate mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DPM1 PE=1 SV=3
16	P77757	3.65e-23	98.2	322	0.262	0.211	ARNC_ECOLI Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli (strain K12) OX=83333 GN=arnC PE=1 SV=1
17	Q9Y673	2.58e-14	73.6	324	0.235	0.188	ALG5_HUMAN Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG5 PE=1 SV=1
18	B3VA58	5.04e-14	71.6	251	0.246	0.255	AGLK_METVO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminyltransferase OS=Methanococcus voltae OX=2188 GN=aglK PE=1 SV=1
19	Q9DB25	5.65e-14	72.4	324	0.242	0.194	ALG5_MOUSE Dolichyl-phosphate beta-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg5 PE=1 SV=1
20	Q9SLN0	2.18e-13	70.9	336	0.212	0.164	Q9SLN0_ARATH dolichyl-phosphate beta-glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=At2g39630 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00535 Glycos_transf_2	1.5e-35	134.0	Glycosyl transferase family 2
2	PF10111 Glyco_tranf_2_2	0.2	22.7	Glycosyltransferase like family 2
3	PF13641 Glyco_tranf_2_3	1.8e-06	39.5	Glycosyltransferase like family 2
4	PF13704 Glyco_tranf_2_4	1.8e+02	14.1	Glycosyl transferase family 2
5	PF13506 Glyco_transf_21	0.32	22.0	Glycosyl transferase family 21
6	PF18708 MapZ_C2	2.2e+02	13.5	MapZ extracellular C-terminal domain 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360644

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322181	0.999	Dolichol phosphate-mannose biosynthesis regulatory protein
2	9606.ENSP00000357384	0.999	Dolichol-phosphate mannosyltransferase subunit 3
3	9606.ENSP00000361667	0.990	Dolichol kinase
4	9606.ENSP00000386597	0.987	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
5	9606.ENSP00000261534	0.985	Protein O-mannosyl-transferase 2
6	9606.ENSP00000361302	0.985	Protein O-mannosyl-transferase 1
7	9606.ENSP00000380793	0.981	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
8	9606.ENSP00000361625	0.975	Dolichyldiphosphatase 1
9	9606.ENSP00000262374	0.973	Chitobiosyldiphosphodolichol beta-mannosyltransferase
10	9606.ENSP00000373713	0.972	Phosphatidylinositide phosphatase SAC1
11	9606.ENSP00000357069	0.958	GPI mannosyltransferase 1
12	9606.ENSP00000164305	0.943	GPI mannosyltransferase 3
13	9606.ENSP00000239891	0.943	ALG5, dolichyl-phosphate beta-glucosyltransferase
14	9606.ENSP00000250124	0.933	Mannose-P-dolichol utilization defect 1 protein
15	9606.ENSP00000350949	0.922	Mannose-1-phosphate guanyltransferase alpha
16	9606.ENSP00000363260	0.921	GPI mannosyltransferase 2
17	9606.ENSP00000309092	0.888	Mannose-1-phosphate guanyltransferase beta
18	9606.ENSP00000360149	0.869	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
19	9606.ENSP00000370194	0.858	GDP-mannose 4,6 dehydratase
20	9606.ENSP00000353104	0.842	Dehydrodolichyl diphosphate synthase complex subunit DHDDS

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004582	1.000	dolichyl-phosphate beta-D-mannosyltransferase activity
GO:0005488	0.996	binding
GO:0005515	0.647	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044255	0.998	cellular lipid metabolic process
GO:0006720	0.993	isoprenoid metabolic process
GO:0006066	0.992	alcohol metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:1901135	0.981	carbohydrate derivative metabolic process
GO:0043170	0.830	macromolecule metabolic process
GO:1901564	0.761	organonitrogen compound metabolic process
GO:0044249	0.732	cellular biosynthetic process
GO:1901576	0.701	organic substance biosynthetic process
GO:0019538	0.654	protein metabolic process
GO:1901137	0.601	carbohydrate derivative biosynthetic process
GO:0043412	0.559	macromolecule modification
GO:0044260	0.532	cellular macromolecule metabolic process
GO:0036211	0.488	protein modification process
GO:1901566	0.485	organonitrogen compound biosynthetic process
GO:0009101	0.468	glycoprotein biosynthetic process
GO:0070085	0.466	glycosylation
GO:0006486	0.464	protein glycosylation
GO:0034641	0.302	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.989	endomembrane system
GO:0016020	0.963	membrane
GO:0005737	0.947	cytoplasm
GO:0031090	0.860	organelle membrane
GO:0005783	0.815	endoplasmic reticulum
GO:0032991	0.796	protein-containing complex
GO:0031984	0.701	organelle subcompartment
GO:0005789	0.667	endoplasmic reticulum membrane
GO:1902494	0.393	catalytic complex
GO:0005634	0.382	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21184	1.000	a dolichyl phosphate + GDP-alpha-D-mannose = a dolichyl beta-D-mannosyl phosphate + GDP
EC:2.4.1.83	1.000	dolichyl-phosphate beta-D-mannosyltransferase.

[back to server]