StarFunc result for job id O60774

User Input

>input (539 residues)
MSKRVGIIGAGVSGLAAIWCCLEEGLEPTCFERSDDVGGLWKFSDHTEEGRASIYQSVFT
NSSKEMMCFPDFPYPDDYPNYIHHSKLQEYIKTYAQKKDLLRYIQFETLVSGIKKCPSFL
VTGQWVVVTEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDYKNPE
AFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGYPWDMMYVTRFA
SFLRNVLPSFISDWLYVQKMNTWFKHENYGLMPLNGSLRKEPVFNDELPSRILCGTLSIK
PSVKEFTETSAVFEDGTMFEAIDSVIFATGYDYSYPFLDETIMKSRNNEVTLFKGIFPPL
MEKPTLAVIGLVQSLGAAIPTADLQAWWAAKVFANSCTLPTTNEMMDDTDEKMGKKLKCM
FSSFFMFGQSQTLQTDYITYVDELGSFIGAKPNIPWLFLTDPRLALEVYFGPCSPYQFRL
MGPGKWDGARNAILTQWNRTVKPTRTRVVSEVQRPHPFYNLLKMLSFPLLLLAVTLTFY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EQ76	0.964	0.978	4.612E-99	531	0.733	0.744	Q9EQ76.pdb.gz	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
2	AFDB:P31513	0.972	0.985	8.660E-98	532	0.707	0.716	P31513.pdb.gz	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
3	AFDB:Q8K2I3	0.922	0.929	6.659E-85	535	0.553	0.557	Q8K2I3.pdb.gz	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
4	AFDB:Q99518	0.923	0.930	9.379E-84	535	0.553	0.557	Q99518.pdb.gz	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
5	AFDB:Q95LA2	0.923	0.935	5.576E-83	532	0.571	0.579	Q95LA2.pdb.gz	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
6	AFDB:P36365	0.921	0.933	9.884E-82	532	0.557	0.564	P36365.pdb.gz	FMO1_RAT Flavin-containing monooxygenase 1 OS=Rattus norvegicus OX=10116 GN=Fmo1 PE=1 SV=2
7	AFDB:P16549	0.922	0.934	2.947E-81	532	0.555	0.562	P16549.pdb.gz	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
8	AFDB:Q01740	0.922	0.934	1.474E-80	532	0.553	0.560	Q01740.pdb.gz	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
9	AFDB:P97872	0.915	0.925	1.837E-76	533	0.499	0.505	P97872.pdb.gz	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
10	AFDB:A0A024QYY6	0.924	0.935	3.880E-76	533	0.481	0.486	A0A024QYY6.pdb.gz
11	PDB:2xlrC	0.603	0.714	1.326E-28	452	0.202	0.241	2xlrC.pdb.gz	Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
12	PDB:2gv8A	0.601	0.725	1.867E-27	442	0.232	0.283	2gv8A.pdb.gz	Mechanism of action of a flavin-containing monooxygenase.
13	PDB:3uozA	0.532	0.532	7.724E-20	540	0.156	0.156	3uozA.pdb.gz	Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
14	PDB:3s5wB	0.465	0.583	6.045E-14	414	0.122	0.159	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
15	PDB:5xhuA	0.272	0.402	1.802E-13	329	0.137	0.225	5xhuA.pdb.gz	Crystal structure of ycgT from bacillus subtilis
16	PDB:4b65A	0.468	0.539	5.678E-12	456	0.122	0.145	4b65A.pdb.gz	Structural Insight Into the Mechanism of Oxygen Activation and Substrate Selectivity of Flavin-Dependent N-Hydroxylating Monooxygenases.
17	PDB:4o5qA	0.329	0.339	7.569E-12	521	0.108	0.111	4o5qA.pdb.gz	Structure, mechanism and ensemble formation of the alkylhydroperoxide reductase subunits AhpC and AhpF from Escherichia coli
18	PDB:3itjB	0.317	0.478	1.069E-11	319	0.100	0.169	3itjB.pdb.gz	Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
19	PDB:1f6mA	0.354	0.549	5.999E-11	320	0.108	0.181	1f6mA.pdb.gz	Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
20	PDB:1q1wA	0.353	0.433	6.713E-10	422	0.102	0.130	1q1wA.pdb.gz	Crystal structure of putidaredoxin reductase from Pseudomonas putida, the final structural component of the cytochrome P450cam monooxygenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16549	0.0	636	532	0.553	0.560	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
2	P31512	0.0	587	558	0.510	0.493	FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens OX=9606 GN=FMO4 PE=1 SV=3
3	P31513	0.0	808	532	0.709	0.718	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
4	P36365	0.0	627	532	0.553	0.560	FMO1_RAT Flavin-containing monooxygenase 1 OS=Rattus norvegicus OX=10116 GN=Fmo1 PE=1 SV=2
5	P36367	0.0	572	555	0.518	0.503	FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus OX=9986 GN=FMO4 PE=2 SV=2
6	P49326	0.0	560	533	0.477	0.482	FMO5_HUMAN Flavin-containing monooxygenase 5 OS=Homo sapiens OX=9606 GN=FMO5 PE=1 SV=2
7	P50285	0.0	635	532	0.555	0.562	FMO1_MOUSE Flavin-containing monooxygenase 1 OS=Mus musculus OX=10090 GN=Fmo1 PE=1 SV=1
8	P97872	0.0	578	533	0.505	0.510	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
9	Q01740	0.0	634	532	0.551	0.558	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
10	Q8K2I3	0.0	664	535	0.560	0.564	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
11	Q8K4C0	0.0	575	533	0.488	0.493	FMO5_RAT Flavin-containing monooxygenase 5 OS=Rattus norvegicus OX=10116 GN=Fmo5 PE=1 SV=3
12	Q8VHG0	0.0	565	560	0.499	0.480	FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus OX=10090 GN=Fmo4 PE=1 SV=3
13	Q95LA2	0.0	639	532	0.573	0.581	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
14	Q99518	0.0	664	535	0.560	0.564	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
15	Q9EQ76	0.0	849	531	0.731	0.742	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
16	G5EBJ9	4.15e-119	363	529	0.364	0.371	G5EBJ9_CAEEL Flavin-containing monooxygenase OS=Caenorhabditis elegans OX=6239 GN=fmo-2 PE=1 SV=1
17	Q9LMA1	3.39e-36	143	530	0.269	0.274	FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=FMO1 PE=2 SV=1
18	Q7K3U4	3.37e-33	133	429	0.147	0.184	Q7K3U4_DROME Flavin-containing monooxygenase OS=Drosophila melanogaster OX=7227 GN=Fmo-2 PE=2 SV=1
19	Q94K43	8.33e-33	132	457	0.204	0.241	GSOX2_ARATH Flavin-containing monooxygenase FMO GS-OX2 OS=Arabidopsis thaliana OX=3702 GN=FMOGS-OX2 PE=1 SV=1
20	Q6NZ32	1.16e-32	132	449	0.134	0.160	Q6NZ32_DANRE Flavin-containing monooxygenase OS=Danio rerio OX=7955 GN=sb:cb897 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	2.2	19.1	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF01262 AlaDh_PNT_C	1.8e+02	12.9	Alanine dehydrogenase/PNT, C-terminal domain
3	PF01266 DAO	0.18	23.0	FAD dependent oxidoreductase
4	PF00743 FMO-like	6.2e-264	888.0	Flavin-binding monooxygenase-like
5	PF01134 GIDA	8.5e+02	10.4	Glucose inhibited division protein A
6	PF07991 IlvN	23	16.0	Acetohydroxy acid isomeroreductase, NADPH-binding domain
7	PF13434 Lys_Orn_oxgnase	0.019	25.7	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
8	PF13450 NAD_binding_8	0.007	27.9	NAD(P)-binding Rossmann-like domain
9	PF13454 NAD_binding_9	12	17.4	FAD-NAD(P)-binding
10	PF02789 Peptidase_M17_N	3.6e+02	12.4	Cytosol aminopeptidase family, N-terminal domain
11	PF00070 Pyr_redox	0.61	22.0	Pyridine nucleotide-disulphide oxidoreductase
12	PF07992 Pyr_redox_2	1.4e-06	39.3	Pyridine nucleotide-disulphide oxidoreductase
13	PF13738 Pyr_redox_3	2.3e-13	61.7	Pyridine nucleotide-disulphide oxidoreductase
14	PF01488 Shikimate_DH	1.3e+02	14.0	Shikimate / quinate 5-dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000002779

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000045445	0.929	Pan troglodytes cytochrome P450, family 3, subfamily A, polypeptide 67 (CYP3A7), mRNA
2	9598.ENSPTRP00000024888	0.918	A cytochrome P450 monooxygenase involved in the metabolism of fatty acids, steroids and retinoids. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA). Metabolizes endocannabinoid arachidonoylethanolamide (anandamide) to 20-hydroxyeicosatetraenoic acid ethanolamide (20-HETE-EA) and 8,9-, 11,12-, and 14,15-epoxyeicosatrienoic acid eth [...]
3	9598.ENSPTRP00000004853	0.916	Uncharacterized protein
4	9598.ENSPTRP00000011076	0.650	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
5	9598.ENSPTRP00000033034	0.549	NADPH--cytochrome P450 reductase
6	9598.ENSPTRP00000050903	0.548	Proline rich 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016709	0.999	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0005488	0.996	binding
GO:0005515	0.948	protein binding
GO:0097159	0.915	organic cyclic compound binding
GO:1901363	0.914	heterocyclic compound binding
GO:0036094	0.887	small molecule binding
GO:0000166	0.803	nucleotide binding
GO:0004499	0.777	N,N-dimethylaniline monooxygenase activity
GO:0043167	0.762	ion binding
GO:0043168	0.655	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044281	0.990	small molecule metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:1901564	0.965	organonitrogen compound metabolic process
GO:0044238	0.942	primary metabolic process
GO:1901360	0.890	organic cyclic compound metabolic process
GO:0065007	0.625	biological regulation
GO:0006082	0.509	organic acid metabolic process
GO:0042221	0.497	response to chemical
GO:0034641	0.476	cellular nitrogen compound metabolic process
GO:0006805	0.451	xenobiotic metabolic process
GO:0044283	0.441	small molecule biosynthetic process
GO:0044249	0.422	cellular biosynthetic process
GO:1901576	0.406	organic substance biosynthetic process
GO:0016053	0.334	organic acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005783	0.990	endoplasmic reticulum
GO:0016020	0.985	membrane
GO:0005789	0.965	endoplasmic reticulum membrane
GO:0031974	0.505	membrane-enclosed lumen
GO:0043233	0.405	organelle lumen
GO:0070013	0.377	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.13.-	0.999	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.
RHEA:24468	0.777	H(+) + N,N-dimethylaniline + NADPH + O2 = H2O + N,N-dimethylaniline N-oxide + NADP(+)
EC:1.14.13.8	0.777	flavin-containing monooxygenase.

[back to server]