StarFunc result for job id O60779

User Input

>input (497 residues)
MDVPGPVSRRAAAAAATVLLRTARVRRECWFLPTALLCAYGFFASLRPSEPFLTPYLLGP
DKNLTEREVFNEIYPVWTYSYLVLLFPVFLATDYLRYKPVVLLQGLSLIVTWFMLLYAQG
LLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILV
SVAGWSLFSLNVISLTCVSVAFAVAWFLPMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTD
TPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSRPLLCWSV
WWALSTCGYFQVVNYTQGLWEKVMPSRYAAIYNGGVEAVSTLLGAVAVFAVGYIKISWST
WGEMTLSLFSLLIAAAVYIMDTVGNIWVCYASYVVFRIIYMLLITIATFQIAANLSMERY
ALVFGVNTFIALALQTLLTLIVVDASGLGLEITTQFLIYASYFALIAVVFLASGAVSVMK
KCRKLEDPQSSSQVTTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EQN9	0.902	0.901	9.461E-56	498	0.905	0.904	Q9EQN9.pdb.gz	S19A2_MOUSE Thiamine transporter 1 OS=Mus musculus OX=10090 GN=Slc19a2 PE=1 SV=1
2	AFDB:Q9BZV2	0.820	0.821	2.397E-38	496	0.485	0.486	Q9BZV2.pdb.gz	S19A3_HUMAN Thiamine transporter 2 OS=Homo sapiens OX=9606 GN=SLC19A3 PE=1 SV=1
3	AFDB:Q99PL8	0.827	0.842	1.614E-36	488	0.465	0.473	Q99PL8.pdb.gz	S19A3_MOUSE Thiamine transporter 2 OS=Mus musculus OX=10090 GN=Slc19a3 PE=1 SV=2
4	AFDB:F1N2M7	0.795	0.778	7.688E-32	508	0.384	0.376	F1N2M7.pdb.gz	F1N2M7_BOVIN Reduced folate transporter OS=Bos taurus OX=9913 GN=SLC19A1 PE=3 SV=3
5	AFDB:P41438	0.803	0.780	4.388E-30	512	0.366	0.355	P41438.pdb.gz	S19A1_MOUSE Reduced folate transporter OS=Mus musculus OX=10090 GN=Slc19a1 PE=1 SV=1
6	AFDB:Q62866	0.797	0.774	6.910E-30	512	0.370	0.359	Q62866.pdb.gz	S19A1_RAT Reduced folate transporter OS=Rattus norvegicus OX=10116 GN=Slc19a1 PE=1 SV=2
7	AFDB:P41440	0.789	0.665	3.785E-28	591	0.374	0.315	P41440.pdb.gz	S19A1_HUMAN Reduced folate transporter OS=Homo sapiens OX=9606 GN=SLC19A1 PE=1 SV=3
8	AFDB:A0A0R4IHG0	0.547	0.548	1.334E-10	495	0.153	0.154	A0A0R4IHG0.pdb.gz
9	AFDB:A8WG95	0.514	0.473	1.008E-9	554	0.167	0.150	A8WG95.pdb.gz	A8WG95_DANRE Membrane-associated transporter protein OS=Danio rerio OX=7955 GN=aim1 PE=2 SV=1
10	AFDB:Q7RTY1	0.600	0.588	1.587E-9	509	0.109	0.106	Q7RTY1.pdb.gz	MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens OX=9606 GN=SLC16A9 PE=1 SV=1
11	PDB:7wsmA	0.528	0.559	4.815E-7	464	0.139	0.149	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
12	PDB:6oopA	0.539	0.656	6.168E-7	392	0.131	0.166	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
13	PDB:7dl9A	0.537	0.635	7.901E-7	405	0.113	0.138	7dl9A.pdb.gz
14	PDB:6thaA	0.519	0.566	1.055E-6	448	0.133	0.147	6thaA.pdb.gz
15	PDB:1pw4A	0.527	0.589	1.731E-6	434	0.121	0.138	1pw4A.pdb.gz
16	PDB:7bc7A	0.482	0.534	3.084E-6	432	0.113	0.130	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
17	PDB:7sptA	0.482	0.503	5.496E-6	470	0.113	0.119	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
18	PDB:5oxpA	0.508	0.538	5.969E-6	462	0.113	0.121	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
19	PDB:6gs1A	0.507	0.528	7.646E-6	472	0.119	0.125	6gs1A.pdb.gz
20	PDB:6fmrA	0.489	0.508	7.969E-6	475	0.147	0.154	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60779	0.0	1006	497	1.000	1.000	S19A2_HUMAN Thiamine transporter 1 OS=Homo sapiens OX=9606 GN=SLC19A2 PE=1 SV=2
2	Q9EQN9	0.0	842	498	0.895	0.894	S19A2_MOUSE Thiamine transporter 1 OS=Mus musculus OX=10090 GN=Slc19a2 PE=1 SV=1
3	Q9BZV2	7.74e-160	464	496	0.483	0.484	S19A3_HUMAN Thiamine transporter 2 OS=Homo sapiens OX=9606 GN=SLC19A3 PE=1 SV=1
4	Q99PL8	1.03e-153	448	488	0.467	0.475	S19A3_MOUSE Thiamine transporter 2 OS=Mus musculus OX=10090 GN=Slc19a3 PE=1 SV=2
5	F1N2M7	2.60e-114	348	508	0.394	0.386	F1N2M7_BOVIN Reduced folate transporter OS=Bos taurus OX=9913 GN=SLC19A1 PE=3 SV=3
6	P41440	4.96e-109	337	591	0.372	0.313	S19A1_HUMAN Reduced folate transporter OS=Homo sapiens OX=9606 GN=SLC19A1 PE=1 SV=3
7	Q62866	2.81e-98	307	512	0.360	0.350	S19A1_RAT Reduced folate transporter OS=Rattus norvegicus OX=10116 GN=Slc19a1 PE=1 SV=2
8	P41438	5.98e-97	304	512	0.354	0.344	S19A1_MOUSE Reduced folate transporter OS=Mus musculus OX=10090 GN=Slc19a1 PE=1 SV=1
9	Q53S99	2.33e-06	49.7	150	0.044	0.147	CB083_HUMAN Folate transporter-like protein C2orf83 OS=Homo sapiens OX=9606 GN=C2orf83 PE=1 SV=1
10	P9WG29	1.3	33.9	362	0.042	0.058	RPFB_MYCTU Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1
11	A8K3C2	7.2	30.4	133	0.044	0.165	A8K3C2_HUMAN NECAP endocytosis associated 1, isoform CRA_a OS=Homo sapiens OX=9606 GN=NECAP1 PE=1 SV=1
12	F4JPS4	9.2	31.6	1013	0.052	0.026	F4JPS4_ARATH Calcineurin-like metallo-phosphoesterase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g11800 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01770 Folate_carrier	2.9e-174	591.3	Reduced folate carrier
2	PF07690 MFS_1	1.7e-05	35.6	Major Facilitator Superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000236137

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258403	0.811	Thiamine transporter 2
2	9606.ENSP00000385312	0.773	Mitochondrial thiamine pyrophosphate carrier
3	9606.ENSP00000349396	0.722	ATP-binding cassette sub-family D member 4
4	9606.ENSP00000353165	0.692	Thiamin pyrophosphokinase 1
5	9606.ENSP00000262030	0.686	ATP synthase subunit beta, mitochondrial
6	9606.ENSP00000340465	0.683	Sodium-dependent phosphate transporter 2
7	9606.ENSP00000305974	0.677	Solute carrier organic anion transporter family member 1A2
8	9606.ENSP00000440288	0.668	ATP-binding cassette sub-family B member 9
9	9606.ENSP00000055077	0.654	Replication factor C subunit 2
10	9606.ENSP00000411096	0.646	ATP binding cassette subfamily A member 13
11	9606.ENSP00000470801	0.625	Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)
12	9606.ENSP00000272542	0.618	Sodium-dependent phosphate transporter 1
13	9606.ENSP00000285238	0.606	Canalicular multispecific organic anion transporter 2
14	9606.ENSP00000256433	0.602	Immediate early response 3-interacting protein 1
15	9606.ENSP00000294360	0.600	UPF0587 protein C1orf123
16	9606.ENSP00000261200	0.588	ATP-binding cassette sub-family C member 9
17	9606.ENSP00000332208	0.566	DNA-binding protein RFX6
18	9606.ENSP00000365837	0.561	tRNA pseudouridine synthase A
19	9606.ENSP00000273158	0.556	Solute carrier family 25 member 38
20	9606.ENSP00000356780	0.555	Coiled-coil domain-containing protein 181

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901682	1.000	sulfur compound transmembrane transporter activity
GO:1901474	1.000	azole transmembrane transporter activity
GO:0090482	1.000	vitamin transmembrane transporter activity
GO:0015101	1.000	organic cation transmembrane transporter activity
GO:0005488	0.979	binding
GO:0005515	0.969	protein binding
GO:0015234	0.969	thiamine transmembrane transporter activity
GO:0008514	0.900	organic anion transmembrane transporter activity
GO:0015075	0.791	monoatomic ion transmembrane transporter activity
GO:1901702	0.756	salt transmembrane transporter activity
GO:0046943	0.735	carboxylic acid transmembrane transporter activity
GO:0022804	0.624	active transmembrane transporter activity
GO:0022853	0.591	active monoatomic ion transmembrane transporter activity
GO:0015291	0.578	secondary active transmembrane transporter activity
GO:0072349	0.402	modified amino acid transmembrane transporter activity
GO:0042887	0.355	amide transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0072348	0.997	sulfur compound transport
GO:0015695	0.997	organic cation transport
GO:0009987	0.995	cellular process
GO:0071705	0.958	nitrogen compound transport
GO:0008152	0.872	metabolic process
GO:0071704	0.859	organic substance metabolic process
GO:0044237	0.857	cellular metabolic process
GO:0055085	0.768	transmembrane transport
GO:0051180	0.742	vitamin transport
GO:0006807	0.685	nitrogen compound metabolic process
GO:1901360	0.621	organic cyclic compound metabolic process
GO:1901564	0.619	organonitrogen compound metabolic process
GO:0046483	0.618	heterocycle metabolic process
GO:0044281	0.474	small molecule metabolic process
GO:0006725	0.470	cellular aromatic compound metabolic process
GO:0034641	0.387	cellular nitrogen compound metabolic process
GO:0006766	0.378	vitamin metabolic process
GO:0006767	0.369	water-soluble vitamin metabolic process
GO:0032501	0.362	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.408	cytoplasm
GO:0043231	0.377	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34919	0.969	thiamine(in) = thiamine(out)

[back to server]