StarFunc result for job id O60806

User Input

>input (448 residues)
MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNE
MIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHS
CVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRM
VTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHVTY
SHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCEHYSGLRGHRQAPYPSAYMHR
NHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTIS
NGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVST
WTAVASHPFAGWGGPGAGGHHSPSSLDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60806	1.000	1.000	2.073E-75	448	1.000	1.000	O60806.pdb.gz	TBX19_HUMAN T-box transcription factor TBX19 OS=Homo sapiens OX=9606 GN=TBX19 PE=1 SV=3
2	AFDB:D4A4W8	0.502	0.515	1.649E-46	436	0.556	0.571	D4A4W8.pdb.gz	D4A4W8_RAT T-box transcription factor T OS=Rattus norvegicus OX=10116 GN=Tbxt PE=4 SV=2
3	AFDB:P24781	0.504	0.522	5.865E-45	432	0.542	0.562	P24781.pdb.gz	TBXT_XENLA T-box transcription factor T OS=Xenopus laevis OX=8355 GN=tbxt PE=1 SV=1
4	AFDB:F1NZI2	0.493	0.510	2.306E-44	433	0.547	0.566	F1NZI2.pdb.gz
5	AFDB:Q07998	0.539	0.567	2.926E-44	423	0.491	0.520	Q07998.pdb.gz	TBXTA_DANRE T-box transcription factor T-A OS=Danio rerio OX=7955 GN=tbxta PE=1 SV=1
6	AFDB:P55965	0.407	0.264	1.624E-31	697	0.408	0.263	P55965.pdb.gz	BYN_DROME T-related protein OS=Drosophila melanogaster OX=7227 GN=byn PE=2 SV=2
7	AFDB:G1K2W9	0.396	0.411	1.067E-28	430	0.261	0.272	G1K2W9.pdb.gz
8	AFDB:Q19691	0.410	0.433	2.054E-28	423	0.250	0.265	Q19691.pdb.gz	TBX2_CAEEL T-box protein 2 OS=Caenorhabditis elegans OX=6239 GN=tbx-2 PE=1 SV=1
9	AFDB:O95947	0.392	0.402	3.115E-28	436	0.275	0.282	O95947.pdb.gz	TBX6_HUMAN T-box transcription factor TBX6 OS=Homo sapiens OX=9606 GN=TBX6 PE=1 SV=2
10	AFDB:P70327	0.411	0.421	5.995E-28	436	0.295	0.303	P70327.pdb.gz	TBX6_MOUSE T-box transcription factor TBX6 OS=Mus musculus OX=10090 GN=Tbx6 PE=2 SV=2
11	PDB:1yycA	0.157	0.317	1.502E-3	174	0.065	0.167	1yycA.pdb.gz
12	PDB:7tysA	0.159	0.189	2.188E-2	361	0.056	0.069	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
13	PDB:4f38B	0.109	0.206	2.616E-2	192	0.056	0.130	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
14	PDB:4ziqA	0.168	0.064	2.776E-2	1450	0.033	0.010	4ziqA.pdb.gz
15	PDB:3s3sA	0.120	0.092	3.319E-2	620	0.056	0.040	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease
16	PDB:5a42A	0.167	0.059	3.319E-2	1597	0.031	0.009	5a42A.pdb.gz
17	PDB:2iqyA	0.115	0.219	3.522E-2	190	0.045	0.105	2iqyA.pdb.gz
18	PDB:4n6rB	0.161	0.313	3.738E-2	198	0.051	0.116	4n6rB.pdb.gz
19	PDB:1wkoA	0.129	0.289	4.743E-2	165	0.047	0.127	1wkoA.pdb.gz
20	PDB:6iggA	0.136	0.279	4.743E-2	170	0.042	0.112	6iggA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60806	0.0	920	448	1.000	1.000	TBX19_HUMAN T-box transcription factor TBX19 OS=Homo sapiens OX=9606 GN=TBX19 PE=1 SV=3
2	Q99ME7	0.0	825	446	0.920	0.924	TBX19_MOUSE T-box transcription factor TBX19 OS=Mus musculus OX=10090 GN=Tbx19 PE=2 SV=1
3	P24781	1.10e-164	472	432	0.518	0.537	TBXT_XENLA T-box transcription factor T OS=Xenopus laevis OX=8355 GN=tbxt PE=1 SV=1
4	D4A4W8	2.84e-162	466	437	0.545	0.558	D4A4W8_RAT T-box transcription factor T OS=Rattus norvegicus OX=10116 GN=Tbxt PE=4 SV=2
5	P79777	3.14e-162	466	433	0.520	0.538	TBXT_CHICK T-box transcription factor T OS=Gallus gallus OX=9031 GN=TBXT PE=2 SV=1
6	J3KP65	1.62e-160	462	436	0.533	0.548	J3KP65_HUMAN T-box transcription factor T OS=Homo sapiens OX=9606 GN=TBXT PE=1 SV=9
7	P20293	1.26e-159	459	436	0.542	0.557	TBXT_MOUSE T-box transcription factor T OS=Mus musculus OX=10090 GN=Tbxt PE=1 SV=1
8	O15178	1.26e-157	454	435	0.531	0.547	TBXT_HUMAN T-box transcription factor T OS=Homo sapiens OX=9606 GN=TBXT PE=1 SV=1
9	Q07998	8.19e-142	414	423	0.471	0.499	TBXTA_DANRE T-box transcription factor T-A OS=Danio rerio OX=7955 GN=tbxta PE=1 SV=1
10	A0A8I6AEA5	1.47e-124	369	396	0.464	0.525	A0A8I6AEA5_RAT T-box transcription factor T OS=Rattus norvegicus OX=10116 GN=Tbxt PE=4 SV=1
11	P55965	2.32e-96	306	697	0.317	0.204	BYN_DROME T-related protein OS=Drosophila melanogaster OX=7227 GN=byn PE=2 SV=2
12	F1R688	1.43e-57	200	543	0.243	0.201	F1R688_DANRE T-box transcription factor 4 OS=Danio rerio OX=7955 GN=tbx4 PE=4 SV=1
13	Q9IAK8	2.87e-57	198	492	0.237	0.215	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
14	O95947	5.29e-57	196	436	0.248	0.255	TBX6_HUMAN T-box transcription factor TBX6 OS=Homo sapiens OX=9606 GN=TBX6 PE=1 SV=2
15	P87377	7.62e-57	196	455	0.219	0.215	VEGTA_XENLA T-box protein VegT-A OS=Xenopus laevis OX=8355 GN=vegt-a PE=1 SV=2
16	Q9PWE8	1.26e-56	197	521	0.237	0.203	TBX5_CHICK T-box transcription factor TBX5 OS=Gallus gallus OX=9031 GN=TBX5 PE=1 SV=1
17	P70327	4.65e-56	193	436	0.228	0.234	TBX6_MOUSE T-box transcription factor TBX6 OS=Mus musculus OX=10090 GN=Tbx6 PE=2 SV=2
18	O93288	4.88e-56	196	541	0.205	0.170	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
19	Q99593	4.92e-56	195	518	0.208	0.180	TBX5_HUMAN T-box transcription factor TBX5 OS=Homo sapiens OX=9606 GN=TBX5 PE=1 SV=2
20	P70326	5.23e-56	195	518	0.208	0.180	TBX5_MOUSE T-box transcription factor TBX5 OS=Mus musculus OX=10090 GN=Tbx5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	1.9e-65	231.8	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356795

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342931	0.867	Pituitary-specific positive transcription factor 1
2	9606.ENSP00000360811	0.826	LIM/homeobox protein Lhx3
3	9606.ENSP00000263726	0.792	LIM/homeobox protein Lhx4
4	9606.ENSP00000265340	0.765	Pituitary homeobox 1
5	9606.ENSP00000256592	0.747	Thyrotropin subunit beta
6	9606.ENSP00000384092	0.746	Pro-opiomelanocortin
7	9606.ENSP00000482232	0.732	Glycoprotein hormones, alpha polypeptide
8	9606.ENSP00000362690	0.731	Steroidogenic factor 1
9	9606.ENSP00000261700	0.726	RNA transcription, translation and transport factor protein
10	9606.ENSP00000226413	0.712	Gonadotropin-releasing hormone receptor
11	9606.ENSP00000356094	0.700	Vasopressin V1b receptor
12	9606.ENSP00000320180	0.697	Growth hormone-releasing hormone receptor
13	9606.ENSP00000295934	0.682	Homeobox expressed in ES cells 1
14	9606.ENSP00000311290	0.678	Homeobox protein prophet of Pit-1
15	9606.ENSP00000416606	0.677	Follitropin subunit beta
16	9606.ENSP00000302150	0.649	Prolactin
17	9606.ENSP00000295108	0.624	Neurogenic differentiation factor 1
18	9606.ENSP00000345681	0.605	Endothelial transcription factor GATA-2
19	9606.ENSP00000428518	0.597	GDNF family receptor alpha-2
20	9606.ENSP00000361669	0.588	Homeobox protein ESX1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000976	0.976	transcription cis-regulatory region binding
GO:0003700	0.954	DNA-binding transcription factor activity
GO:0000981	0.746	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.587	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.993	anatomical structure development
GO:0080090	0.989	regulation of primary metabolic process
GO:0031326	0.988	regulation of cellular biosynthetic process
GO:2001141	0.976	regulation of RNA biosynthetic process
GO:0006355	0.973	regulation of DNA-templated transcription
GO:0006357	0.948	regulation of transcription by RNA polymerase II
GO:0009987	0.844	cellular process
GO:0048518	0.799	positive regulation of biological process
GO:0048522	0.738	positive regulation of cellular process
GO:0032501	0.736	multicellular organismal process
GO:0007275	0.704	multicellular organism development
GO:0048731	0.666	system development
GO:0050896	0.498	response to stimulus
GO:0048513	0.479	animal organ development
GO:0009893	0.444	positive regulation of metabolic process
GO:0010604	0.416	positive regulation of macromolecule metabolic process
GO:0031328	0.406	positive regulation of cellular biosynthetic process
GO:0010557	0.402	positive regulation of macromolecule biosynthetic process
GO:0051254	0.400	positive regulation of RNA metabolic process
GO:0045893	0.377	positive regulation of DNA-templated transcription
GO:0009653	0.370	anatomical structure morphogenesis
GO:0051716	0.337	cellular response to stimulus
GO:0045944	0.320	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.979	nucleoplasm
GO:0043232	0.937	intracellular non-membrane-bounded organelle
GO:0005737	0.698	cytoplasm
GO:0005694	0.477	chromosome
GO:0000785	0.363	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]