StarFunc result for job id O60811

User Input

>input (474 residues)
MSIQAPPRLLELAGQSLLRDQALSISAMEELPRVLYLPLFREAFSRRHFQTLTVMVQAWP
FTCLPLVSLMKTLHLEPLKALLEGLHMLLTQKDRPRRWKLQVLDLRDVDENFWARWPGAW
ALSCFPEAMSKRQTAEDCPRTGEHQPLKVFIDICLKEIPQDECLRYLFQWVYQRRGLVHL
CCSKLVNYLTPIKYLRKSLKIIYINSIGELEIHNTCWPHLIRKLYCYLKEMKTLCKLVFS
RCHHYTSDNELEGWLVTRFTSVFLRLEHLQLLKIKLITFFSGHLEQLIRCLQNPLENLEL
TCGNLLEEDLKCLSQFPSLGYLKHLNLSYVLLFRISLEPLGALLEKIAASLETLVLEGCQ
IHYSQLSAILPGLSCCSQLTTFYFGSNCMSIDALKDLLRHTSGLSKLSLETYPAPEESLN
SLVRVNWEIFTPLRAELMCTLREFRQPKRIFIGPTPCPSCGSSPSEELELHLCC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DUQ2	0.882	0.875	2.061E-47	478	0.483	0.479	P0DUQ2.pdb.gz	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
2	AFDB:A0A024R1E6	0.882	0.824	1.049E-41	509	0.445	0.415	A0A024R1E6.pdb.gz
3	AFDB:E9Q5G7	0.824	0.790	1.317E-36	496	0.352	0.337	E9Q5G7.pdb.gz	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
4	AFDB:Q810Y8	0.832	0.824	2.080E-34	479	0.308	0.305	Q810Y8.pdb.gz	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
5	AFDB:Q99MW3	0.760	0.784	4.188E-34	458	0.363	0.376	Q99MW3.pdb.gz	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
6	AFDB:Q15048	0.571	0.552	2.711E-22	493	0.257	0.247	Q15048.pdb.gz	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
7	AFDB:Q9NPP4	0.406	0.220	1.852E-10	1024	0.146	0.067	Q9NPP4.pdb.gz	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
8	AFDB:Q3UP24	0.402	0.219	6.834E-9	1024	0.148	0.068	Q3UP24.pdb.gz	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
9	PDB:4kxfP	0.417	0.262	3.360E-8	866	0.141	0.077	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
10	AFDB:Q8WX94	0.456	0.250	6.924E-8	980	0.150	0.072	Q8WX94.pdb.gz	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
11	AFDB:M0R915	0.363	0.147	2.145E-7	1403	0.148	0.050	M0R915.pdb.gz	M0R915_RAT NLR family, apoptosis inhibitory protein 6 OS=Rattus norvegicus OX=10116 GN=Naip6 PE=4 SV=3
12	PDB:3jblA	0.342	0.207	8.976E-7	909	0.131	0.068	3jblA.pdb.gz
13	PDB:4i6jB	0.349	0.400	5.029E-6	394	0.143	0.173	4i6jB.pdb.gz
14	PDB:7sa1B	0.389	0.311	2.272E-5	624	0.137	0.104	7sa1B.pdb.gz
15	PDB:3oglB	0.319	0.282	4.575E-5	568	0.131	0.109	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
16	PDB:6hkwA	0.297	0.422	4.829E-5	306	0.097	0.150	6hkwA.pdb.gz
17	PDB:7pmkL	0.361	0.360	7.040E-5	475	0.122	0.122	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:1k5dC	0.417	0.551	9.725E-5	344	0.099	0.137	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
19	PDB:2p1nB	0.318	0.273	1.026E-4	571	0.120	0.100	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
20	PDB:7pzcA	0.379	0.195	1.666E-4	1010	0.120	0.056	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DUQ2	2.21e-131	390	478	0.485	0.481	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
2	Q5VXH4	4.83e-131	389	476	0.483	0.481	PRAM6_HUMAN PRAME family member 6 OS=Homo sapiens OX=9606 GN=PRAMEF6 PE=1 SV=1
3	P78395	1.40e-104	323	509	0.449	0.418	PRAME_HUMAN Melanoma antigen preferentially expressed in tumors OS=Homo sapiens OX=9606 GN=PRAME PE=1 SV=1
4	Q99MW3	1.18e-80	259	458	0.348	0.360	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
5	Q810Y8	4.46e-70	232	479	0.310	0.307	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
6	E9Q5G7	3.60e-64	217	496	0.359	0.343	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
7	Q15048	1.44e-23	105	493	0.262	0.252	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
8	Q38C48	0.23	36.6	711	0.074	0.049	Q38C48_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5880 PE=4 SV=1
9	Q9BUY7	0.62	33.9	163	0.061	0.178	EFC11_HUMAN EF-hand calcium-binding domain-containing protein 11 OS=Homo sapiens OX=9606 GN=EFCAB11 PE=1 SV=1
10	Q66X05	2.3	33.5	959	0.086	0.043	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1
11	P0C8K6	3.4	32.7	502	0.051	0.048	RM02_ORYSA Large ribosomal subunit protein uL2m OS=Oryza sativa OX=4530 GN=RPL2 PE=3 SV=1
12	P92812	3.4	32.7	502	0.051	0.048	RM02_ORYSJ Large ribosomal subunit protein uL2m OS=Oryza sativa subsp. japonica OX=39947 GN=RPL2 PE=2 SV=2
13	Q2F969	3.4	32.7	502	0.051	0.048	RM02_ORYSI Large ribosomal subunit protein uL2m OS=Oryza sativa subsp. indica OX=39946 GN=RPL2 PE=3 SV=2
14	Q9R1M5	5.4	32.3	1163	0.141	0.058	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
15	O60603	6.5	32.0	784	0.061	0.037	TLR2_HUMAN Toll-like receptor 2 OS=Homo sapiens OX=9606 GN=TLR2 PE=1 SV=1
16	Q8IMU3	6.6	31.6	400	0.040	0.048	Q8IMU3_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=2 SV=1
17	Q8T8Q6	6.6	31.6	400	0.040	0.048	Q8T8Q6_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=2 SV=1
18	Q8IGM4	6.7	32.0	699	0.046	0.031	Q8IGM4_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=2 SV=1
19	O42888	6.8	31.6	325	0.099	0.145	YBN4_SCHPO Uncharacterized oxidoreductase C8E4.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC8E4.04 PE=3 SV=1
20	B7Z0Q2	6.9	31.6	699	0.046	0.031	B7Z0Q2_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	9.6e+02	11.7	Leucine Rich repeats (2 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240189

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370800	0.742	methyl-CpG binding domain protein 3 like 2
2	9606.ENSP00000380053	0.731	PRD class homeoboxes and pseudogenes
3	9606.ENSP00000272395	0.727	Tripartite motif containing 43
4	9606.ENSP00000359415	0.717	Putative KHDC1-like protein
5	9606.ENSP00000375109	0.709	Keratin-associated protein 13-3
6	9606.ENSP00000321963	0.618	Zinc finger and SCAN domain-containing protein 4
7	9606.ENSP00000386166	0.576	Proline rich 21
8	9606.ENSP00000458065	0.566	Double homeobox protein 4
9	9606.ENSP00000451207	0.561	Double homeobox 4 like 1
10	9606.ENSP00000451411	0.561	Double homeobox 4 like 7
11	9606.ENSP00000485452	0.561	Double homeodomain protein DUX4-s
12	9606.ENSP00000393417	0.517	Caspase-14
13	9606.ENSP00000326225	0.516	Olfactory receptor 2T8
14	9606.ENSP00000373196	0.505	Olfactory receptor 5H6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	0.999	protein-macromolecule adaptor activity
GO:0005515	0.996	protein binding
GO:1990756	0.975	ubiquitin ligase-substrate adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030163	0.997	protein catabolic process
GO:0009987	0.994	cellular process
GO:0044260	0.947	cellular macromolecule metabolic process
GO:0006508	0.924	proteolysis
GO:0044265	0.924	cellular macromolecule catabolic process
GO:0051603	0.911	proteolysis involved in protein catabolic process
GO:0019941	0.885	modification-dependent protein catabolic process
GO:0006511	0.880	ubiquitin-dependent protein catabolic process
GO:0043161	0.772	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0065007	0.600	biological regulation
GO:0032502	0.539	developmental process
GO:0032501	0.438	multicellular organismal process
GO:0050794	0.420	regulation of cellular process
GO:0048856	0.407	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0005634	0.951	nucleus
GO:0005737	0.947	cytoplasm
GO:0032991	0.866	protein-containing complex
GO:0070013	0.833	intracellular organelle lumen
GO:0031981	0.797	nuclear lumen
GO:0071944	0.601	cell periphery
GO:0005654	0.572	nucleoplasm
GO:0016020	0.504	membrane
GO:0005886	0.375	plasma membrane
GO:1902494	0.319	catalytic complex
GO:0031462	0.302	Cul2-RING ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]