StarFunc result for job id O60825

User Input

>input (505 residues)
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTR
YLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEE
NGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPE
RNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVY
YLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVW
TSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRY
PGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTI
FKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPR
NYSVGSRPLKPLSPLRAQDMQEGAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JJH5	0.867	0.787	4.085E-86	557	0.927	0.840	Q9JJH5.pdb.gz	F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus OX=10116 GN=Pfkfb2 PE=1 SV=1
2	PDB:5htkA	0.789	0.932	1.340E-73	425	0.840	0.998	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
3	AFDB:A0A1W2PR17	0.824	0.733	9.757E-72	568	0.663	0.590	A0A1W2PR17.pdb.gz	A0A1W2PR17_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
4	AFDB:P25114	0.829	0.891	2.860E-71	469	0.620	0.667	P25114.pdb.gz	F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus OX=10116 GN=Pfkfb4 PE=1 SV=3
5	AFDB:O35552	0.817	0.744	4.250E-71	555	0.636	0.578	O35552.pdb.gz	F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus OX=10116 GN=Pfkfb3 PE=2 SV=1
6	AFDB:P07953	0.831	0.891	1.682E-69	471	0.612	0.656	P07953.pdb.gz	F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus OX=10116 GN=Pfkfb1 PE=1 SV=3
7	PDB:2axnA	0.809	0.905	1.383E-68	451	0.634	0.710	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
8	AFDB:Q91348	0.827	0.887	4.002E-68	470	0.586	0.630	Q91348.pdb.gz	F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus OX=9031 PE=2 SV=2
9	PDB:1bifA	0.802	0.936	1.543E-65	432	0.594	0.694	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
10	PDB:1k6mA	0.808	0.943	2.168E-65	432	0.608	0.711	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
11	AFDB:Q9N590	0.803	0.901	2.985E-59	450	0.473	0.531	Q9N590.pdb.gz	Q9N590_CAEEL 6-phosphofructo-2-kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pfkb-1.1 PE=1 SV=2
12	AFDB:P32604	0.805	0.898	8.385E-55	452	0.402	0.449	P32604.pdb.gz	F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FBP26 PE=1 SV=2
13	AFDB:Q9MB58	0.746	0.513	4.629E-47	744	0.380	0.258	Q9MB58.pdb.gz	F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana OX=3702 GN=FKFBP PE=1 SV=1
14	AFDB:P40433	0.766	0.473	3.104E-44	827	0.370	0.226	P40433.pdb.gz	6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK26 PE=1 SV=1
15	PDB:6s2rA	0.336	0.682	1.295E-11	234	0.095	0.205	6s2rA.pdb.gz
16	PDB:1e58A	0.325	0.635	2.281E-11	247	0.099	0.202	1e58A.pdb.gz
17	PDB:1riiA	0.309	0.613	5.038E-11	243	0.109	0.226	1riiA.pdb.gz
18	PDB:1qhfA	0.331	0.653	8.873E-11	240	0.103	0.217	1qhfA.pdb.gz	Structure of a phosphoglycerate mutase:3-phosphoglyceric acid complex at 1.7 A.
19	PDB:2h4zA	0.330	0.623	2.752E-10	255	0.099	0.196	2h4zA.pdb.gz	Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
20	PDB:1yjxA	0.323	0.634	3.652E-10	245	0.095	0.196	1yjxA.pdb.gz	Crystal structure of human B-type phosphoglycerate mutase bound with citrate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PR17	0.0	715	568	0.661	0.588	A0A1W2PR17_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
2	F2Z2I2	0.0	696	455	0.634	0.703	F2Z2I2_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
3	O35552	0.0	707	555	0.665	0.605	F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus OX=10116 GN=Pfkfb3 PE=2 SV=1
4	O60825	0.0	1053	505	1.000	1.000	F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2
5	P07953	0.0	665	471	0.606	0.650	F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus OX=10116 GN=Pfkfb1 PE=1 SV=3
6	P16118	0.0	671	471	0.618	0.662	F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens OX=9606 GN=PFKFB1 PE=1 SV=3
7	P25114	0.0	664	469	0.614	0.661	F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus OX=10116 GN=Pfkfb4 PE=1 SV=3
8	P70265	0.0	978	519	0.921	0.896	F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus OX=10090 GN=Pfkfb2 PE=1 SV=2
9	Q16875	0.0	715	520	0.661	0.642	F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
10	Q16877	0.0	667	469	0.614	0.661	F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens OX=9606 GN=PFKFB4 PE=1 SV=6
11	Q28901	0.0	689	463	0.646	0.704	F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus OX=9913 GN=PFKFB3 PE=1 SV=2
12	Q5VX20	0.0	713	526	0.661	0.635	Q5VX20_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
13	Q5W015	0.0	713	513	0.661	0.651	Q5W015_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
14	Q91348	0.0	651	470	0.592	0.636	F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus OX=9031 PE=2 SV=2
15	Q9JJH5	0.0	979	557	0.921	0.835	F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus OX=10116 GN=Pfkfb2 PE=1 SV=1
16	Q9N590	2.73e-174	500	450	0.469	0.527	Q9N590_CAEEL 6-phosphofructo-2-kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pfkb-1.1 PE=1 SV=2
17	P32604	1.35e-140	414	452	0.400	0.447	F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FBP26 PE=1 SV=2
18	Q9MB58	1.62e-111	349	744	0.364	0.247	F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana OX=3702 GN=FKFBP PE=1 SV=1
19	P40433	2.54e-90	295	827	0.339	0.207	6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK26 PE=1 SV=1
20	Q9UTE1	1.45e-87	282	592	0.305	0.260	YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC222.13c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	2.7e-100	345.8	6-phosphofructo-2-kinase
2	PF13671 AAA_33	0.00033	32.3	AAA domain
3	PF00300 His_Phos_1	1.2e-36	137.8	Histidine phosphatase superfamily (branch 1)
4	PF00328 His_Phos_2	54	14.6	Histidine phosphatase superfamily (branch 2)
5	PF08433 KTI12	0.21	22.6	Chromatin associated protein KTI12
6	PF06414 Zeta_toxin	1.3e+02	13.3	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356047

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000443319	0.973	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
2	9606.ENSP00000179259	0.965	Fructose-2,6-bisphosphatase TIGAR
3	9606.ENSP00000408695	0.951	Protein kinase C alpha type
4	9606.ENSP00000345771	0.916	ATP-dependent 6-phosphofructokinase, muscle type
5	9606.ENSP00000318318	0.908	Mannose-6-phosphate isomerase
6	9606.ENSP00000232375	0.903	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4
7	9606.ENSP00000364145	0.903	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1
8	9606.ENSP00000451828	0.892	RAC-alpha serine/threonine-protein kinase
9	9606.ENSP00000309591	0.881	cAMP-dependent protein kinase catalytic subunit alpha
10	9606.ENSP00000359719	0.855	cAMP-dependent protein kinase catalytic subunit beta
11	9606.ENSP00000366488	0.855	cAMP-dependent protein kinase catalytic subunit gamma
12	9606.ENSP00000370517	0.848	ATP-dependent 6-phosphofructokinase, platelet type
13	9606.ENSP00000269848	0.841	ATP-dependent 6-phosphofructokinase, liver type
14	9606.ENSP00000364486	0.834	Fructose-1,6-bisphosphatase isozyme 2
15	9606.ENSP00000290573	0.831	Hexokinase-2
16	9606.ENSP00000263826	0.817	RAC-gamma serine/threonine-protein kinase
17	9606.ENSP00000375892	0.816	RAC-beta serine/threonine-protein kinase
18	9606.ENSP00000263431	0.796	Protein kinase C gamma type
19	9606.ENSP00000305355	0.796	Protein kinase C beta type
20	9606.ENSP00000408025	0.795	Fructose-1,6-bisphosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0050308	0.999	sugar-phosphatase activity
GO:0008443	0.999	phosphofructokinase activity
GO:0003873	0.989	6-phosphofructo-2-kinase activity
GO:0004331	0.981	fructose-2,6-bisphosphate 2-phosphatase activity
GO:0019899	0.975	enzyme binding
GO:0019900	0.967	kinase binding
GO:0042802	0.307	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901135	0.981	carbohydrate derivative metabolic process
GO:0006796	0.979	phosphate-containing compound metabolic process
GO:0044238	0.978	primary metabolic process
GO:0019637	0.977	organophosphate metabolic process
GO:0019318	0.930	hexose metabolic process
GO:0016310	0.914	phosphorylation
GO:0006090	0.908	pyruvate metabolic process
GO:0016052	0.904	carbohydrate catabolic process
GO:0006807	0.892	nitrogen compound metabolic process
GO:0006096	0.864	glycolytic process
GO:0065007	0.831	biological regulation
GO:0050789	0.691	regulation of biological process
GO:0050794	0.646	regulation of cellular process
GO:0019222	0.518	regulation of metabolic process
GO:0031323	0.493	regulation of cellular metabolic process
GO:0080090	0.472	regulation of primary metabolic process
GO:0051174	0.414	regulation of phosphorus metabolic process
GO:0019220	0.399	regulation of phosphate metabolic process
GO:0050896	0.350	response to stimulus
GO:0006109	0.322	regulation of carbohydrate metabolic process
GO:0062012	0.311	regulation of small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0070013	0.996	intracellular organelle lumen
GO:0005634	0.996	nucleus
GO:0005654	0.992	nucleoplasm
GO:0005829	0.983	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:3.1.3.23	0.999	sugar-phosphatase.
RHEA:15653	0.989	ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+)
EC:2.7.1.105	0.989	6-phosphofructo-2-kinase.
RHEA:17289	0.981	beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate
EC:3.1.3.46	0.981	fructose-2,6-bisphosphate 2-phosphatase.

[back to server]