StarFunc result for job id O60826

User Input

>input (627 residues)
MEEADRILIHSLRQAGTAVPPDVQTLRAFTTELVVEAVVRCLRVINPAVGSGLSPLLPLA
MSARFRLAMSLAQACMDLGYPLELGYQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPA
GDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEP
REFQASPLLLPVPTQVPQPVGRVASLLEHHALQLCQQTGRDRPGDEDWVHRTSRLPPQED
TRAQRQRLQKQLTEHLRQSWGLLGAPIQARDLGELLQAWGAGAKTGAPKGSRFTHSEKFT
FHLEPQAQATQVSDVPATSRRPEQVTWAAQEQELESLREQLEGVNRSIEEVEADMKTLGV
SFVQAESECRHSKLSTAEREQALRLKSRAVELLPDGTANLAKLQLVVENSAQRVIHLAGQ
WEKHRVPLLAEYRHLRKLQDCRELESSRRLAEIQELHQSVRAAAEEARRKEEVYKQLMSE
LETLPRDVSRLAYTQRILEIVGNIRKQKEEITKILSDTKELQKEINSLSGKLDRTFAVTD
ELVFKDAKKDDAVRKAYKYLAALHENCSQLIQTIEDTGTIMREVRDLEEQIETELGKKTL
SNLEKIREDYRALRQENAGLLGRVREA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60826	1.000	1.000	4.428E-82	627	1.000	1.000	O60826.pdb.gz	CCD22_HUMAN Coiled-coil domain-containing protein 22 OS=Homo sapiens OX=9606 GN=CCDC22 PE=1 SV=1
2	AFDB:Q9JIG7	0.394	0.394	2.614E-67	627	0.880	0.880	Q9JIG7.pdb.gz	CCD22_MOUSE Coiled-coil domain-containing protein 22 OS=Mus musculus OX=10090 GN=Ccdc22 PE=1 SV=1
3	AFDB:Q567U6	0.152	0.151	3.955E-5	631	0.150	0.149	Q567U6.pdb.gz	CCD93_HUMAN Coiled-coil domain-containing protein 93 OS=Homo sapiens OX=9606 GN=CCDC93 PE=1 SV=2
4	AFDB:Q13751	0.104	0.064	3.228E-3	1172	0.171	0.091	Q13751.pdb.gz	LAMB3_HUMAN Laminin subunit beta-3 OS=Homo sapiens OX=9606 GN=LAMB3 PE=1 SV=1
5	AFDB:Q24185	0.135	0.126	4.659E-3	679	0.147	0.135	Q24185.pdb.gz	HOOK_DROME Protein hook OS=Drosophila melanogaster OX=7227 GN=hook PE=1 SV=2
6	AFDB:Q386N1	0.132	0.118	7.085E-3	709	0.140	0.124	Q386N1.pdb.gz	CFA91_TRYB2 Cilia- and flagella-associated protein 91 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=CFAP91 PE=1 SV=1
7	AFDB:Q54UC9	0.128	0.074	7.085E-3	1193	0.147	0.077	Q54UC9.pdb.gz	KIF3_DICDI Kinesin-related protein 3 OS=Dictyostelium discoideum OX=44689 GN=kif3 PE=1 SV=1
8	AFDB:Q583D3	0.086	0.062	1.639E-2	947	0.156	0.103	Q583D3.pdb.gz	Q583D3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.1000 PE=4 SV=1
9	AFDB:Q38CH8	0.136	0.156	3.073E-2	534	0.128	0.150	Q38CH8.pdb.gz	Q38CH8_TRYB2 Calponin-homology (CH) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7600 PE=4 SV=1
10	AFDB:Q6IVW0	0.138	0.202	3.073E-2	407	0.089	0.138	Q6IVW0.pdb.gz	IFT57_DANRE Intraflagellar transport protein 57 homolog OS=Danio rerio OX=7955 GN=ift57 PE=2 SV=1
11	PDB:4d1eA	0.133	0.101	2.958E-1	859	0.057	0.042	4d1eA.pdb.gz
12	PDB:6awlA	0.062	0.134	9.873E-1	217	0.043	0.124	6awlA.pdb.gz
13	PDB:7ea3J	0.071	0.056	1.218	883	0.067	0.048	7ea3J.pdb.gz
14	PDB:3aqbD	0.053	0.083	1.425	325	0.027	0.052	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
15	PDB:7tveG	0.055	0.096	1.425	307	0.054	0.111	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
16	PDB:1f7uA	0.063	0.065	1.667	606	0.024	0.025	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding
17	PDB:7sx8D	0.132	0.176	1.757	448	0.037	0.051	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
18	PDB:7r97A	0.073	0.129	1.852	226	0.043	0.119	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
19	PDB:4cy4E	0.059	0.097	1.951	317	0.035	0.069	4cy4E.pdb.gz
20	PDB:1oyzA	0.057	0.106	2.056	273	0.045	0.103	1oyzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60826	0.0	1264	627	1.000	1.000	CCD22_HUMAN Coiled-coil domain-containing protein 22 OS=Homo sapiens OX=9606 GN=CCDC22 PE=1 SV=1
2	Q9JIG7	0.0	1098	627	0.880	0.880	CCD22_MOUSE Coiled-coil domain-containing protein 22 OS=Mus musculus OX=10090 GN=Ccdc22 PE=1 SV=1
3	Q7TT49	0.051	39.3	1713	0.093	0.034	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
4	P42259	0.23	37.0	534	0.065	0.077	HTR2_NATPH Sensory rhodopsin II transducer OS=Natronomonas pharaonis OX=2257 GN=htr2 PE=1 SV=1
5	Q9UPV0	0.24	37.0	1460	0.091	0.039	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
6	Q9XEE9	0.83	35.0	463	0.057	0.078	ALG11_ARATH GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG11 PE=1 SV=2
7	P98171	0.90	35.0	946	0.030	0.020	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
8	Q387A9	0.96	35.0	752	0.040	0.033	Q387A9_TRYB2 DM10 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.47.0006 PE=4 SV=1
9	P36022	1.3	34.7	4092	0.046	0.007	DYHC_YEAST Dynein heavy chain, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DYN1 PE=1 SV=1
10	Q00799	1.3	34.7	2867	0.059	0.013	RBP2_PLAVB Reticulocyte-binding protein 2 OS=Plasmodium vivax (strain Belem) OX=31273 GN=RBP-2 PE=3 SV=2
11	O43566	1.4	34.3	566	0.062	0.069	RGS14_HUMAN Regulator of G-protein signaling 14 OS=Homo sapiens OX=9606 GN=RGS14 PE=1 SV=4
12	M9PD87	4.2	33.1	2134	0.054	0.016	M9PD87_DROME CENP-meta, isoform D OS=Drosophila melanogaster OX=7227 GN=cmet PE=1 SV=1
13	M9PFL9	4.5	33.1	2132	0.054	0.016	M9PFL9_DROME CENP-meta, isoform F OS=Drosophila melanogaster OX=7227 GN=cmet PE=1 SV=1
14	Q9SAF6	5.4	32.7	1128	0.046	0.026	CRWN2_ARATH Protein CROWDED NUCLEI 2 OS=Arabidopsis thaliana OX=3702 GN=CRWN2 PE=1 SV=1
15	Q99104	6.5	32.3	1853	0.072	0.024	MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus OX=10090 GN=Myo5a PE=1 SV=2
16	Q8IHP3	7.8	32.3	2055	0.041	0.013	Q8IHP3_PLAF7 Membrane associated erythrocyte binding-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1147800.1 PE=4 SV=1
17	F1RCN2	9.1	32.0	1502	0.043	0.018	F1RCN2_DANRE CECR2 histone acetyl-lysine reader OS=Danio rerio OX=7955 GN=cecr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05667 CCDC22	6.9e-214	723.8	Coiled-coil domain-containing protein 22
2	PF08649 DASH_Dad1	7e+02	11.8	DASH complex subunit Dad1
3	PF07889 DUF1664	5.4e+02	12.0	Protein of unknown function (DUF1664)
4	PF06103 DUF948	2.6e+02	13.3	Bacterial protein of unknown function (DUF948)
5	PF12018 FAP206	5.5	17.9	Domain of unknown function
6	PF08702 Fib_alpha	4.2e+02	12.5	Fibrinogen alpha/beta chain family
7	PF04353 Rsd_AlgQ	8.3e+02	11.4	Regulator of RNA polymerase sigma(70) subunit, Rsd/AlgQ

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365401

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365477	0.999	Coiled-coil domain-containing protein 93
2	9606.ENSP00000308236	0.994	COMM domain-containing protein 1
3	9606.ENSP00000274458	0.991	COMM domain-containing protein 10
4	9606.ENSP00000394331	0.991	COMM domain-containing protein 5
5	9606.ENSP00000419475	0.991	COMM domain-containing protein 2
6	9606.ENSP00000267935	0.989	COMM domain-containing protein 4
7	9606.ENSP00000263401	0.986	COMM domain-containing protein 9
8	9606.ENSP00000251143	0.981	UPF0505 protein C16orf62
9	9606.ENSP00000370984	0.977	COMM domain-containing protein 8
10	9606.ENSP00000366032	0.974	COMM domain-containing protein 3
11	9606.ENSP00000278980	0.970	COMM domain-containing protein 7
12	9606.ENSP00000311399	0.965	Down syndrome critical region gene 3
13	9606.ENSP00000348054	0.959	COMM domain containing 6
14	9606.ENSP00000354688	0.944	Protein FAM45A
15	9606.ENSP00000480853	0.937	Vacuolar protein sorting-associated protein 29
16	9606.ENSP00000376167	0.909	COP9 signalosome complex subunit 1
17	9606.ENSP00000268717	0.906	COP9 signalosome complex subunit 3
18	9606.ENSP00000304102	0.906	COP9 signalosome complex subunit 6
19	9606.ENSP00000264389	0.905	COP9 signalosome complex subunit 4
20	9606.ENSP00000299259	0.905	COP9 signalosome complex subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097602	0.993	cullin family protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.991	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0060255	0.959	regulation of macromolecule metabolic process
GO:0080090	0.957	regulation of primary metabolic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0016192	0.943	vesicle-mediated transport
GO:0051246	0.929	regulation of protein metabolic process
GO:0009893	0.927	positive regulation of metabolic process
GO:0031323	0.917	regulation of cellular metabolic process
GO:0048519	0.909	negative regulation of biological process
GO:0048522	0.906	positive regulation of cellular process
GO:0098876	0.900	vesicle-mediated transport to the plasma membrane
GO:0048523	0.871	negative regulation of cellular process
GO:1902531	0.816	regulation of intracellular signal transduction
GO:0010468	0.801	regulation of gene expression
GO:0031326	0.789	regulation of cellular biosynthetic process
GO:0016197	0.785	endosomal transport
GO:0065009	0.783	regulation of molecular function
GO:0032456	0.779	endocytic recycling
GO:0010556	0.773	regulation of macromolecule biosynthetic process
GO:0010604	0.773	positive regulation of macromolecule metabolic process
GO:0019219	0.767	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.747	regulation of DNA-templated transcription
GO:0009894	0.733	regulation of catabolic process
GO:0048193	0.713	Golgi vesicle transport
GO:0048878	0.678	chemical homeostasis
GO:0051090	0.673	regulation of DNA-binding transcription factor activity
GO:0030162	0.665	regulation of proteolysis
GO:1903050	0.652	regulation of proteolysis involved in protein catabolic process
GO:0006892	0.646	post-Golgi vesicle-mediated transport
GO:0009967	0.620	positive regulation of signal transduction
GO:0048585	0.609	negative regulation of response to stimulus
GO:0043122	0.605	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0050801	0.594	monoatomic ion homeostasis
GO:0044092	0.593	negative regulation of molecular function
GO:0051173	0.585	positive regulation of nitrogen compound metabolic process
GO:0055080	0.582	monoatomic cation homeostasis
GO:0051235	0.581	maintenance of location
GO:0055070	0.571	copper ion homeostasis
GO:0023057	0.568	negative regulation of signaling
GO:0043433	0.566	negative regulation of DNA-binding transcription factor activity
GO:0019725	0.518	cellular homeostasis
GO:0008152	0.510	metabolic process
GO:0031329	0.510	regulation of cellular catabolic process
GO:0009968	0.489	negative regulation of signal transduction
GO:0006893	0.477	Golgi to plasma membrane transport
GO:0051247	0.456	positive regulation of protein metabolic process
GO:0071704	0.437	organic substance metabolic process
GO:0031325	0.391	positive regulation of cellular metabolic process
GO:0044238	0.387	primary metabolic process
GO:0006807	0.364	nitrogen compound metabolic process
GO:0033036	0.358	macromolecule localization
GO:0043170	0.340	macromolecule metabolic process
GO:0050896	0.318	response to stimulus
GO:0009896	0.316	positive regulation of catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.998	nucleoplasm
GO:0005813	0.997	centrosome
GO:0032991	0.947	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]