StarFunc result for job id O60829

User Input

>input (102 residues)
MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVE
GDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:O60829	1.000	1.000	1.157E-14	102	1.000	1.000	O60829.pdb.gz	PAGE4_HUMAN P antigen family member 4 OS=Homo sapiens OX=9606 GN=PAGE4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60829	3.10e-68	201	102	1.000	1.000	PAGE4_HUMAN P antigen family member 4 OS=Homo sapiens OX=9606 GN=PAGE4 PE=1 SV=1
2	Q7Z2X7	9.80e-12	58.5	111	0.441	0.405	PAGE2_HUMAN P antigen family member 2 OS=Homo sapiens OX=9606 GN=PAGE2 PE=1 SV=1
3	Q96GU1	1.99e-11	58.2	130	0.461	0.362	PAGE5_HUMAN P antigen family member 5 OS=Homo sapiens OX=9606 GN=PAGE5 PE=1 SV=2
4	Q5JUK9	9.22e-11	56.2	113	0.333	0.301	PAGE3_HUMAN P antigen family member 3 OS=Homo sapiens OX=9606 GN=PAGE3 PE=1 SV=1
5	Q8WTP9	1.84e-07	47.4	111	0.353	0.324	XAGE3_HUMAN X antigen family member 3 OS=Homo sapiens OX=9606 GN=XAGE3 PE=1 SV=1
6	Q96GT9	3.04e-05	41.6	111	0.382	0.351	XAGE2_HUMAN X antigen family member 2 OS=Homo sapiens OX=9606 GN=XAGE2 PE=1 SV=1
7	O75459	0.003	37.0	146	0.216	0.151	PAGE1_HUMAN P antigen family member 1 OS=Homo sapiens OX=9606 GN=PAGE1 PE=1 SV=2
8	Q13069	0.050	33.1	117	0.304	0.265	GAGE5_HUMAN G antigen 5 OS=Homo sapiens OX=9606 GN=GAGE5 PE=1 SV=1
9	Q9UEU5	0.066	32.7	116	0.402	0.353	GGE2D_HUMAN G antigen 2D OS=Homo sapiens OX=9606 GN=GAGE2D PE=1 SV=1
10	A6NGK3	0.22	31.6	116	0.304	0.267	GAG10_HUMAN G antigen 10 OS=Homo sapiens OX=9606 GN=GAGE10 PE=1 SV=2
11	P0CL82	0.37	30.8	117	0.294	0.256	GG12I_HUMAN G antigen 12I OS=Homo sapiens OX=9606 GN=GAGE12I PE=1 SV=1
12	Q13066	0.42	30.8	116	0.392	0.345	GAG2B_HUMAN G antigen 2B/2C OS=Homo sapiens OX=9606 GN=GAGE2B PE=1 SV=1
13	A1L429	0.45	30.8	117	0.294	0.256	GG12C_HUMAN G antigen 12B/C/D/E OS=Homo sapiens OX=9606 GN=GAGE12B PE=1 SV=1
14	A0A158RFV5	0.51	30.8	139	0.284	0.209	A0A158RFV5_HUMAN G antigen 1 OS=Homo sapiens OX=9606 GN=GAGE1 PE=1 SV=1
15	A9LDD9	0.70	30.8	492	0.235	0.049	A9LDD9_DANRE glycine hydroxymethyltransferase OS=Danio rerio OX=7955 GN=shmt2 PE=1 SV=1
16	Q17886	1.1	30.0	382	0.157	0.042	NASP1_CAEEL Protein NASP homolog 1 OS=Caenorhabditis elegans OX=6239 GN=nasp-1 PE=1 SV=1
17	X2J9P4	2.6	29.3	940	0.108	0.012	X2J9P4_DROME Dipeptidyl peptidase 10, isoform B OS=Drosophila melanogaster OX=7227 GN=Dpp10 PE=4 SV=1
18	Q9VMB4	3.1	28.9	935	0.108	0.012	Q9VMB4_DROME Dipeptidyl peptidase 10, isoform A OS=Drosophila melanogaster OX=7227 GN=Dpp10 PE=2 SV=3
19	Q6FIU8	5.7	28.1	4880	0.167	0.003	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05831 GAGE	2.1e-30	116.8	GAGE protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000218068

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358571	0.742	Homeodomain-interacting protein kinase 1
2	9606.ENSP00000370555	0.722	Glycogenin-2
3	9606.ENSP00000360266	0.719	Transcription factor AP-1
4	9606.ENSP00000368927	0.695	Eukaryotic translation initiation factor 1A, X-chromosomal
5	9606.ENSP00000357345	0.681	Dual specificity protein kinase CLK2
6	9606.ENSP00000359668	0.676	Transcription cofactor vestigial-like protein 1
7	9606.ENSP00000370485	0.672	Neuroligin-4, X-linked
8	9606.ENSP00000343244	0.660	Dual specificity protein phosphatase 21
9	9606.ENSP00000362186	0.658	Protocadherin-11 X-linked
10	9606.ENSP00000483599	0.648	Spondin-2
11	9606.ENSP00000217964	0.644	F-box-like/WD repeat-containing protein TBL1X
12	9606.ENSP00000369465	0.630	Gamma-taxilin
13	9606.ENSP00000262848	0.628	cAMP-dependent protein kinase catalytic subunit PRKX
14	9606.ENSP00000475344	0.624	Apelin receptor
15	9606.ENSP00000317214	0.609	Calpain-6
16	9606.ENSP00000369547	0.596	S100 calcium binding protein G
17	9606.ENSP00000362744	0.585	Ribosomal protein S4, X-linked
18	9606.ENSP00000368475	0.577	Zinc finger X-chromosomal protein
19	9606.ENSP00000445135	0.575	NACHT, LRR and PYD domains-containing protein 2
20	9606.ENSP00000256495	0.563	Class E basic helix-loop-helix protein 40

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003677	0.997	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.989	regulation of cellular process
GO:0009966	0.977	regulation of signal transduction
GO:0009889	0.976	regulation of biosynthetic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0009892	0.975	negative regulation of metabolic process
GO:0048523	0.966	negative regulation of cellular process
GO:0050896	0.961	response to stimulus
GO:0031324	0.937	negative regulation of cellular metabolic process
GO:1902531	0.843	regulation of intracellular signal transduction
GO:2000377	0.796	regulation of reactive oxygen species metabolic process
GO:0070302	0.791	regulation of stress-activated protein kinase signaling cascade
GO:1903426	0.790	regulation of reactive oxygen species biosynthetic process
GO:1903201	0.790	regulation of oxidative stress-induced cell death
GO:0060548	0.767	negative regulation of cell death
GO:0043067	0.733	regulation of programmed cell death
GO:0042981	0.714	regulation of apoptotic process
GO:2000378	0.711	negative regulation of reactive oxygen species metabolic process
GO:1903202	0.711	negative regulation of oxidative stress-induced cell death
GO:0043408	0.684	regulation of MAPK cascade
GO:0043066	0.660	negative regulation of apoptotic process
GO:0032872	0.656	regulation of stress-activated MAPK cascade
GO:0009605	0.622	response to external stimulus
GO:0009890	0.571	negative regulation of biosynthetic process
GO:0006950	0.452	response to stress
GO:0009987	0.404	cellular process
GO:0006979	0.334	response to oxidative stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005739	0.999	mitochondrion
GO:0070013	0.332	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]