StarFunc result for job id O60832

User Input

>input (514 residues)
MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFD
KLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGH
SGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGAL
FQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVG
GQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLV
MKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDH
GIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYS
ESAKKEVVAEVVKAPQVVAEAAKTAKRKRESESESDETPPAAPQLIKKEKKKSKKDKKAK
AGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60832	1.000	1.000	2.894E-95	514	1.000	1.000	O60832.pdb.gz	DKC1_HUMAN H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3
2	AFDB:P40615	0.820	0.828	6.635E-85	509	0.821	0.829	P40615.pdb.gz	DKC1_RAT H/ACA ribonucleoprotein complex subunit DKC1 OS=Rattus norvegicus OX=10116 GN=Dkc1 PE=1 SV=4
3	AFDB:Q5ZJH9	0.797	0.794	1.781E-81	516	0.782	0.779	Q5ZJH9.pdb.gz	DKC1_CHICK H/ACA ribonucleoprotein complex subunit DKC1 OS=Gallus gallus OX=9031 GN=DKC1 PE=2 SV=1
4	AFDB:Q498Z9	0.748	0.758	3.709E-79	507	0.733	0.744	Q498Z9.pdb.gz
5	AFDB:O44081	0.769	0.777	8.142E-75	508	0.640	0.648	O44081.pdb.gz	DKC1_DROME H/ACA ribonucleoprotein complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=Nop60B PE=1 SV=1
6	AFDB:Q9LD90	0.736	0.670	3.338E-70	565	0.568	0.517	Q9LD90.pdb.gz	CBF5_ARATH H/ACA ribonucleoprotein complex subunit 4 OS=Arabidopsis thaliana OX=3702 GN=CBF5 PE=1 SV=1
7	AFDB:O14007	0.736	0.798	1.165E-69	474	0.564	0.612	O14007.pdb.gz	CBF5_SCHPO H/ACA ribonucleoprotein complex subunit cbf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbf5 PE=3 SV=1
8	AFDB:Q54T81	0.753	0.718	3.839E-69	540	0.611	0.581	Q54T81.pdb.gz	DKC1_DICDI Probable H/ACA ribonucleoprotein complex subunit 4 OS=Dictyostelium discoideum OX=44689 GN=nola4 PE=1 SV=1
9	AFDB:P33322	0.734	0.780	1.265E-68	483	0.549	0.584	P33322.pdb.gz	CBF5_YEAST H/ACA ribonucleoprotein complex subunit CBF5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CBF5 PE=1 SV=1
10	AFDB:O43100	0.726	0.775	1.501E-68	481	0.551	0.588	O43100.pdb.gz	CBF5_EMENI H/ACA ribonucleoprotein complex subunit CBF5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbf5 PE=2 SV=1
11	PDB:7v9aC	0.705	0.913	9.931E-68	393	0.761	0.995	7v9aC.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
12	PDB:2apoA	0.574	0.961	8.288E-38	304	0.253	0.428	2apoA.pdb.gz	The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.
13	PDB:2rfkA	0.567	0.857	1.884E-36	334	0.253	0.389	2rfkA.pdb.gz	Substrate RNA positioning in the archaeal H/ACA ribonucleoprotein complex.
14	PDB:1k8wA	0.462	0.756	2.864E-20	304	0.142	0.240	1k8wA.pdb.gz	Cocrystal structure of a tRNA Psi55 pseudouridine synthase: nucleotide flipping by an RNA-modifying enzyme.
15	PDB:1sgvB	0.396	0.730	6.152E-19	266	0.134	0.259	1sgvB.pdb.gz
16	PDB:1r3fA	0.442	0.789	8.649E-19	278	0.136	0.252	1r3fA.pdb.gz
17	PDB:2v9kA	0.265	0.289	8.682E-8	467	0.070	0.077	2v9kA.pdb.gz	Crystal Structure of Human Pus10, a Novel Pseudouridine Synthase.
18	PDB:2olwA	0.238	0.620	3.109E-6	179	0.062	0.179	2olwA.pdb.gz
19	PDB:1kskA	0.206	0.407	6.506E-6	234	0.047	0.103	1kskA.pdb.gz	Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP.
20	PDB:2i82A	0.199	0.414	1.709E-5	217	0.062	0.147	2i82A.pdb.gz	Crystal structure of pseudouridine synthase RluA: indirect sequence readout through protein-induced RNA structure

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9IYT0	0.0	771	380	0.737	0.997	C9IYT0_HUMAN Dyskerin pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=9
2	F1Q749	0.0	719	506	0.671	0.682	F1Q749_DANRE Dyskeratosis congenita 1, dyskerin OS=Danio rerio OX=7955 GN=fc87a02 PE=1 SV=1
3	O14007	0.0	587	474	0.545	0.591	CBF5_SCHPO H/ACA ribonucleoprotein complex subunit cbf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbf5 PE=3 SV=1
4	O43100	0.0	599	481	0.537	0.574	CBF5_EMENI H/ACA ribonucleoprotein complex subunit CBF5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbf5 PE=2 SV=1
5	O44081	0.0	655	508	0.597	0.604	DKC1_DROME H/ACA ribonucleoprotein complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=Nop60B PE=1 SV=1
6	O60832	0.0	1051	514	1.000	1.000	DKC1_HUMAN H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3
7	P33322	0.0	602	483	0.535	0.569	CBF5_YEAST H/ACA ribonucleoprotein complex subunit CBF5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CBF5 PE=1 SV=1
8	P40615	0.0	812	509	0.802	0.809	DKC1_RAT H/ACA ribonucleoprotein complex subunit DKC1 OS=Rattus norvegicus OX=10116 GN=Dkc1 PE=1 SV=4
9	Q38CM1	0.0	545	427	0.504	0.607	Q38CM1_TRYB2 Centromere/microtubule binding protein cbf5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0060 PE=3 SV=1
10	Q54T81	0.0	603	540	0.564	0.537	DKC1_DICDI Probable H/ACA ribonucleoprotein complex subunit 4 OS=Dictyostelium discoideum OX=44689 GN=nola4 PE=1 SV=1
11	Q5ZJH9	0.0	775	516	0.732	0.729	DKC1_CHICK H/ACA ribonucleoprotein complex subunit DKC1 OS=Gallus gallus OX=9031 GN=DKC1 PE=2 SV=1
12	Q7ZUT3	0.0	714	497	0.669	0.692	Q7ZUT3_DANRE Dkc1 protein (Fragment) OS=Danio rerio OX=7955 GN=dkc1 PE=2 SV=1
13	Q9ESX5	0.0	877	509	0.879	0.888	DKC1_MOUSE H/ACA ribonucleoprotein complex subunit DKC1 OS=Mus musculus OX=10090 GN=Dkc1 PE=1 SV=4
14	Q9LD90	0.0	591	565	0.580	0.527	CBF5_ARATH H/ACA ribonucleoprotein complex subunit 4 OS=Arabidopsis thaliana OX=3702 GN=CBF5 PE=1 SV=1
15	Q57612	1.40e-84	266	336	0.272	0.417	TRUB_METJA Probable tRNA pseudouridine synthase B OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=truB PE=1 SV=1
16	Q7LWY0	1.56e-82	261	340	0.255	0.385	TRUB_PYRFU Probable tRNA pseudouridine synthase B OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=truB PE=1 SV=1
17	Q97QJ3	3.12e-22	99.0	292	0.128	0.226	TRUB_STRPN tRNA pseudouridine synthase B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=truB PE=1 SV=1
18	Q0WVR7	6.67e-22	101	540	0.128	0.122	Q0WVR7_ARATH tRNA pseudouridine(55) synthase OS=Arabidopsis thaliana OX=3702 GN=At5g14460 PE=1 SV=1
19	P9WHP7	1.24e-21	97.4	298	0.138	0.238	TRUB_MYCTU tRNA pseudouridine synthase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=truB PE=1 SV=1
20	P60340	2.21e-15	79.3	314	0.111	0.182	TRUB_ECOLI tRNA pseudouridine synthase B OS=Escherichia coli (strain K12) OX=83333 GN=truB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08068 DKCLD	3e-28	109.0	DKCLD (NUC011) domain
2	PF01472 PUA	5.7e-15	66.4	PUA domain
3	PF16198 TruB_C_2	1.5e-18	78.0	tRNA pseudouridylate synthase B C-terminal domain
4	PF01509 TruB_N	2.8e-18	78.2	TruB family pseudouridylate synthase (N terminal domain)
5	PF03657 UPF0113	30	16.3	UPF0113 PUA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221801	0.999	rRNA 2'-O-methyltransferase fibrillarin
2	9606.ENSP00000226796	0.999	H/ACA ribonucleoprotein complex subunit 1
3	9606.ENSP00000264279	0.999	Nucleolar protein 58
4	9606.ENSP00000274606	0.999	H/ACA ribonucleoprotein complex subunit 2
5	9606.ENSP00000309572	0.999	Telomerase reverse transcriptase
6	9606.ENSP00000315182	0.999	Protein SHQ1 homolog
7	9606.ENSP00000318297	0.999	RuvB-like 1
8	9606.ENSP00000324203	0.999	Telomerase Cajal body protein 1
9	9606.ENSP00000332198	0.999	H/ACA ribonucleoprotein complex subunit 3
10	9606.ENSP00000370589	0.999	Nucleolar protein 56
11	9606.ENSP00000383949	0.999	NHP2-like protein 1
12	9606.ENSP00000274054	0.997	H/ACA ribonucleoprotein complex non-core subunit NAF1
13	9606.ENSP00000385410	0.997	Nucleolar and coiled-body phosphoprotein 1
14	9606.ENSP00000473172	0.997	RuvB-like 2
15	9606.ENSP00000346725	0.992	Pescadillo homolog
16	9606.ENSP00000402338	0.991	Ribosome production factor 2 homolog
17	9606.ENSP00000229214	0.989	KRR1 small subunit processome component homolog
18	9606.ENSP00000338573	0.989	Guanine nucleotide-binding protein-like 3-like protein
19	9606.ENSP00000455106	0.989	Ribosome biogenesis protein BOP1
20	9606.ENSP00000460871	0.989	Ribosomal L1 domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.994	RNA binding
GO:0003824	0.983	catalytic activity
GO:0009982	0.966	pseudouridine synthase activity
GO:0030515	0.500	snoRNA binding
GO:0140640	0.372	catalytic activity, acting on a nucleic acid
GO:0034061	0.316	DNA polymerase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0034470	0.987	ncRNA processing
GO:0022613	0.985	ribonucleoprotein complex biogenesis
GO:0006364	0.983	rRNA processing
GO:0050794	0.939	regulation of cellular process
GO:0000154	0.934	rRNA modification
GO:0019222	0.926	regulation of metabolic process
GO:0060255	0.919	regulation of macromolecule metabolic process
GO:0080090	0.892	regulation of primary metabolic process
GO:0031323	0.869	regulation of cellular metabolic process
GO:0051171	0.867	regulation of nitrogen compound metabolic process
GO:0051052	0.862	regulation of DNA metabolic process
GO:0001522	0.861	pseudouridine synthesis
GO:2000278	0.838	regulation of DNA biosynthetic process
GO:0048518	0.792	positive regulation of biological process
GO:0048522	0.745	positive regulation of cellular process
GO:0050790	0.636	regulation of catalytic activity
GO:0051972	0.608	regulation of telomerase activity
GO:0009893	0.553	positive regulation of metabolic process
GO:0051173	0.544	positive regulation of nitrogen compound metabolic process
GO:0010604	0.475	positive regulation of macromolecule metabolic process
GO:0031325	0.434	positive regulation of cellular metabolic process
GO:0044260	0.422	cellular macromolecule metabolic process
GO:0010557	0.362	positive regulation of macromolecule biosynthetic process
GO:0031328	0.350	positive regulation of cellular biosynthetic process
GO:0045935	0.349	positive regulation of nucleobase-containing compound metabolic process
GO:0010468	0.344	regulation of gene expression
GO:0016043	0.334	cellular component organization
GO:0048519	0.302	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005730	0.999	nucleolus
GO:0032991	0.964	protein-containing complex
GO:0005829	0.910	cytosol
GO:0016604	0.902	nuclear body
GO:0015030	0.827	Cajal body
GO:1990904	0.751	ribonucleoprotein complex
GO:0140513	0.675	nuclear protein-containing complex
GO:1902494	0.589	catalytic complex
GO:0005732	0.353	sno(s)RNA-containing ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.4.-.-	0.966	Intramolecular transferases.
EC:2.7.7.-	0.316	Nucleotidyltransferases.

[back to server]