StarFunc result for job id O60840

User Input

>input (1977 residues)
MSESEGGKDTTPEPSPANGAGPGPEWGLCPGPPAVEGESSGASGLGTPKRRNQHSKHKTV
AVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASSGSGRACTLNQTECR
GRWPGPNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKQREKQQMEEDLRGYLDWITQAEELDMEDPS
ADDNLGSMAEEGRAGHRPQLAELTNRRRGRLRWFSHSTRSTHSTSSHASLPASDTGSMTE
TQGDEDEEEGALASCTRCLNKIMKTRVCRRLRRANRVLRARCRRAVKSNACYWAVLLLVF
LNTLTIASEHHGQPVWLTQIQEYANKVLLCLFTVEMLLKLYGLGPSAYVSSFFNRFDCFV
VCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLL
LLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDG
IMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKDKGGEKSNEK
DLPQENEGLVPGVEKEEEEGARREGADMEEEEEEEEEEEEEEEEEGAGGVELLQEVVPKE
KVVPIPEGSAFFCLSQTNPLRKGCHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAHSFR
NHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNMLDLLVVSVSLISFGIHSS
AISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQ
LFKGKFYTCTDEAKHTPQECKGSFLVYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALF
TVSTFEGWPALLYKAIDAYAEDHGPIYNYRVEISVFFIVYIIIIAFFMMNIFVGFVIITF
RAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLI
LLNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKHYFTDAWNTFDAL
IVVGSIVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTF
IKSFQALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCP
HRVACKRLVAMNMPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKR
MKQKLLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGNDAAPSTSSALQAG
LRSLQDLGPEMRQALTCDTEEEEEEGQEGVEEEDEKDLETNKATMVSQPSARRGSGISVS
LPVGDRLPDSLSFGPSDDDRGTPTSSQPSVPQAGSNTHRRGSGALIFTIPEEGNSQPKGT
KGQNKQDEDEEVPDRLSYLDEQAGTPPCSVLLPPHRAQRYMDGHLVPRRRLLPPTPAGRK
PSFTIQCLQRQGSCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAA
GEGYLGRSSGPLRTFTCLHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVAL
AKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5gjwA	0.631	0.959	0.000	1291	0.473	0.724	5gjwA.pdb.gz	Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
2	PDB:7uhfA	0.610	0.974	0.000	1230	0.523	0.840	7uhfA.pdb.gz	Structural basis for pore blockade of human voltage-gated calcium channel Ca v 1.3 by motion sickness drug cinnarizine.
3	AFDB:P07293	0.699	0.737	0.000	1873	0.555	0.586	P07293.pdb.gz	CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1
4	AFDB:P27732	0.721	0.648	0.000	2203	0.655	0.588	P27732.pdb.gz	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
5	AFDB:Q01668	0.721	0.661	0.000	2161	0.666	0.609	Q01668.pdb.gz	CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens OX=9606 GN=CACNA1D PE=1 SV=2
6	AFDB:Q8MQA1	0.713	0.749	0.000	1877	0.512	0.540	Q8MQA1.pdb.gz	Q8MQA1_CAEEL Voltage-dependent L-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=egl-19 PE=1 SV=1
7	AFDB:Q9JIS7	0.846	0.843	0.000	1985	0.904	0.900	Q9JIS7.pdb.gz	CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus OX=10090 GN=Cacna1f PE=1 SV=1
8	PDB:7jpxA	0.555	0.979	8.849E-103	1116	0.416	0.737	7jpxA.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
9	PDB:7mixA	0.611	0.900	4.759E-93	1326	0.345	0.514	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
10	PDB:7vfsA	0.594	0.915	2.174E-92	1266	0.327	0.510	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
11	PDB:3jbrA	0.489	0.764	1.428E-71	1224	0.409	0.661	3jbrA.pdb.gz
12	PDB:7w9lA	0.530	0.724	1.089E-58	1420	0.201	0.280	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
13	PDB:7wliA	0.505	0.860	2.077E-55	1135	0.194	0.338	7wliA.pdb.gz	Structure, gating, and pharmacology of human Ca V 3.3 channel.
14	PDB:7we4A	0.490	0.841	3.911E-55	1122	0.177	0.311	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
15	PDB:7xveA	0.501	0.757	1.565E-52	1276	0.185	0.287	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
16	AFDB:Q96QT4	0.109	0.114	4.192E-5	1865	0.089	0.094	Q96QT4.pdb.gz	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1
17	AFDB:F4J8G7	0.051	0.049	5.271E-4	2138	0.088	0.081	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
18	AFDB:Q6PR54	0.045	0.040	9.926E-4	2419	0.078	0.064	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
19	AFDB:Q9Y3Q4	0.072	0.103	1.792E-3	1203	0.065	0.106	Q9Y3Q4.pdb.gz	HCN4_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Homo sapiens OX=9606 GN=HCN4 PE=1 SV=1
20	AFDB:F6NYL9	0.074	0.112	2.121E-3	1130	0.059	0.104	F6NYL9.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZMH8	3519	1960	0.907	0.915	A0A8I5ZMH8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
2	A0A8I5ZS49	3548	1973	0.914	0.915	A0A8I5ZS49_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
3	A1XIQ4	3572	1980	0.918	0.916	A1XIQ4_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=2 SV=1
4	F8W3Z0	743	2280	0.205	0.178	F8W3Z0_DANRE Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b OS=Danio rerio OX=7955 GN=CACNA1Ab PE=2 SV=2
5	G3V9W8	3570	1980	0.917	0.916	G3V9W8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
6	G5EFB0	1229	1523	0.360	0.467	G5EFB0_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-2 PE=3 SV=2
7	G5EG02	1746	1783	0.492	0.546	G5EG02_CAEEL Voltage-dependent L-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=egl-19 PE=1 SV=1
8	O00555	734	2506	0.201	0.158	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
9	O35505	2296	2169	0.643	0.586	CAC1C_CAVPO Voltage-dependent L-type calcium channel subunit alpha-1C OS=Cavia porcellus OX=10141 GN=CACNA1C PE=1 SV=2
10	O55017	758	2327	0.198	0.168	CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus OX=10090 GN=Cacna1b PE=1 SV=1
11	O60840	4084	1977	1.000	1.000	CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens OX=9606 GN=CACNA1F PE=1 SV=2
12	O89089	764	2333	0.198	0.168	O89089_RAT Voltage-dependent N-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1b PE=1 SV=1
13	P07293	2073	1873	0.535	0.564	CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1
14	P15381	2259	2171	0.632	0.575	CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus OX=9986 GN=CACNA1C PE=1 SV=1
15	P22002	2209	2169	0.582	0.530	CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus OX=10116 GN=Cacna1c PE=1 SV=1
16	P27732	2281	2203	0.596	0.535	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
17	P27884	732	2424	0.192	0.157	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
18	P54282	744	2212	0.191	0.170	CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
19	P91645	1343	1851	0.375	0.401	CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=cac PE=1 SV=3
20	P97445	741	2368	0.190	0.158	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16885 CAC1F_C	4.3e-183	620.2	Voltage-gated calcium channel subunit alpha, C-term
2	PF08763 Ca_chan_IQ	4.1e-26	102.3	Voltage gated calcium channel IQ domain
3	PF16118 DUF4834	23	17.4	Domain of unknown function (DUF4834)
4	PF14575 EphA2_TM	8e+02	12.2	Ephrin type-A receptor 2 transmembrane domain
5	PF16905 GPHH	2e-24	96.5	Voltage-dependent L-type calcium channel, IQ-associated
6	PF07219 HemY_N	7.1e+02	11.8	HemY protein N-terminus
7	PF00520 Ion_trans	1e-246	825.7	Ion transport protein
8	PF08016 PKD_channel	1.4e-10	52.5	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372169	0.984	Voltage-dependent calcium channel subunit alpha-2/delta-4
2	9606.ENSP00000349320	0.978	Voltage-dependent calcium channel subunit alpha-2/delta-1
3	9606.ENSP00000301050	0.976	Voltage-dependent L-type calcium channel subunit beta-3
4	9606.ENSP00000438949	0.966	Voltage-dependent L-type calcium channel subunit beta-4
5	9606.ENSP00000320025	0.957	Voltage-dependent L-type calcium channel subunit beta-2
6	9606.ENSP00000324960	0.956	Calcium-binding protein 4
7	9606.ENSP00000266376	0.952	Voltage-dependent L-type calcium channel subunit alpha-1C
8	9606.ENSP00000355192	0.952	Voltage-dependent L-type calcium channel subunit alpha-1S
9	9606.ENSP00000377840	0.933	Voltage-dependent L-type calcium channel subunit beta-1
10	9606.ENSP00000270458	0.929	Voltage-dependent calcium channel gamma-8 subunit
11	9606.ENSP00000262138	0.928	Voltage-dependent calcium channel gamma-4 subunit
12	9606.ENSP00000375647	0.924	Voltage-dependent calcium channel gamma-7 subunit
13	9606.ENSP00000005284	0.923	Voltage-dependent calcium channel gamma-3 subunit
14	9606.ENSP00000252729	0.905	Voltage-dependent calcium channel gamma-6 subunit
15	9606.ENSP00000288139	0.902	Voltage-dependent L-type calcium channel subunit alpha-1D
16	9606.ENSP00000226021	0.868	Voltage-dependent calcium channel gamma-1 subunit
17	9606.ENSP00000352608	0.854	Ryanodine receptor 1
18	9606.ENSP00000418081	0.853	Voltage-dependent calcium channel subunit alpha-2/delta-2
19	9606.ENSP00000340328	0.825	Nyctalopin
20	9606.ENSP00000264399	0.812	cGMP-dependent protein kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0008331	0.995	high voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007601	0.988	visual perception
GO:0009987	0.776	cellular process
GO:0065007	0.562	biological regulation
GO:0050789	0.485	regulation of biological process
GO:0050794	0.412	regulation of cellular process
GO:0050896	0.382	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.996	membrane-bounded organelle
GO:0032991	0.937	protein-containing complex
GO:0042995	0.933	cell projection
GO:0043005	0.923	neuron projection
GO:0036477	0.894	somatodendritic compartment
GO:0044297	0.848	cell body
GO:0043204	0.789	perikaryon
GO:0005737	0.717	cytoplasm
GO:0005929	0.706	cilium
GO:0097730	0.650	non-motile cilium
GO:1902495	0.643	transmembrane transporter complex
GO:0098797	0.634	plasma membrane protein complex
GO:0097733	0.626	photoreceptor cell cilium
GO:0034703	0.617	cation channel complex
GO:0001750	0.600	photoreceptor outer segment
GO:0005891	0.466	voltage-gated calcium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]