StarFunc result for job id O60841

User Input

>input (1220 residues)
MGKKQKNKSEDSTKDDIDLDALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDEDDILK
ELEELSLEAQGIKADRETVAVKPTENNEEEFTSKDKKKKGQKGKKQSFDDNDSEELEDKD
SKSKKTAKPKVEMYSGSDDDDDFNKLPKKAKGKAQKSNKKWDGSEEDEDNSKKIKERSRI
NSSGESGDESDEFLQSRKGQKKNQKNKPGPNIESGNEDDDASFKIKTVAQKKAEKKERER
KKRDEEKAKLRKLKEKEELETGKKDQSKQKESQRKFEEETVKSKVTVDTGVIPASEEKAE
TPTAAEDDNEGDKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKR
EEEERIKRLEELEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAE
ATLKLLQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEVMEQGV
PEKEETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHIEVKENPEEEEEEEEE
EEEDEESEEEEEEEGESEGSEGDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRT
KEERAYDKAKRRIEKRRLEHSKNVNTEKLRAPIICVLGHVDTGKTKILDKLRHTHVQDGE
AGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLC
DIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQK
KNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVE
LTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQ
IRGLLLPPPMKELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLK
DELIHELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMK
ASVMLEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQK
QEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSKNFVDIGIVTS
IEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRD
EMQKSDWQLIVELKKVFEII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60841	1.000	1.000	0.000	1220	1.000	1.000	O60841.pdb.gz	IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4
2	AFDB:P39730	0.497	0.600	2.468E-91	1002	0.342	0.416	P39730.pdb.gz	IF2P_YEAST Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUN12 PE=1 SV=2
3	PDB:7po27	0.312	0.619	4.359E-36	571	0.113	0.242	7po27.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
4	PDB:7unvx	0.309	0.585	3.609E-33	593	0.110	0.226	7unvx.pdb.gz	Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
5	PDB:3jcjf	0.296	0.637	2.673E-30	509	0.111	0.267	3jcjf.pdb.gz	Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association.
6	PDB:7pubIA	0.259	0.436	1.103E-28	693	0.106	0.186	7pubIA.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
7	PDB:1ob2A	0.191	0.536	8.321E-16	393	0.051	0.158	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU
8	PDB:6ji2A	0.167	0.439	2.261E-15	432	0.072	0.204	6ji2A.pdb.gz	Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.
9	PDB:7nshBC	0.184	0.301	7.255E-15	700	0.065	0.113	7nshBC.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
10	PDB:7pjvx	0.187	0.307	9.577E-15	703	0.053	0.092	7pjvx.pdb.gz	Structural mechanism of GTPase-powered ribosome-tRNA movement.
11	PDB:3jcex	0.182	0.355	3.631E-14	586	0.061	0.128	3jcex.pdb.gz	EF4 disengages the peptidyl-tRNA CCA end and facilitates back-translocation on the 70S ribosome
12	PDB:7a5gZ	0.177	0.493	4.793E-14	394	0.053	0.165	7a5gZ.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
13	AFDB:Q9SLF3	0.131	0.133	1.002E-5	1206	0.085	0.086	Q9SLF3.pdb.gz	TC132_ARATH Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC132 PE=1 SV=1
14	AFDB:Q5JWF2	0.108	0.123	1.900E-4	1037	0.096	0.113	Q5JWF2.pdb.gz	GNAS1_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens OX=9606 GN=GNAS PE=1 SV=2
15	AFDB:Q63803	0.114	0.120	4.620E-4	1144	0.098	0.105	Q63803.pdb.gz	GNAS1_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Rattus norvegicus OX=10116 GN=Gnas PE=1 SV=3
16	AFDB:Q6R0H7	0.115	0.123	8.996E-4	1133	0.091	0.098	Q6R0H7.pdb.gz	GNAS1_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Mus musculus OX=10090 GN=Gnas PE=1 SV=1
17	AFDB:O81283	0.122	0.102	1.483E-3	1503	0.105	0.085	O81283.pdb.gz	TC159_ARATH Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC159 PE=1 SV=1
18	AFDB:A0A0B4LFV4	0.108	0.168	2.584E-3	742	0.081	0.133	A0A0B4LFV4.pdb.gz	A0A0B4LFV4_DROME Rad, Gem/Kir family member 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Rgk2 PE=4 SV=1
19	AFDB:Q9QY02	0.048	0.075	3.713E-2	738	0.051	0.084	Q9QY02.pdb.gz	YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ythdc1 PE=1 SV=2
20	AFDB:Q8NB66	0.048	0.035	4.637E-2	2214	0.104	0.057	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2GUV7	0.0	1793	1216	0.888	0.891	IF2P_RAT Eukaryotic translation initiation factor 5B OS=Rattus norvegicus OX=10116 GN=Eif5b PE=1 SV=1
2	F4I420	0.0	684	1294	0.280	0.264	F4I420_ARATH Eukaryotic translation initiation factor 5B OS=Arabidopsis thaliana OX=3702 GN=EIF5B1 PE=1 SV=1
3	M9ND37	0.0	868	1108	0.332	0.366	M9ND37_DROME Eukaryotic translation initiation factor 5B OS=Drosophila melanogaster OX=7227 GN=eIF5B PE=1 SV=1
4	M9NFL1	0.0	814	1090	0.316	0.353	M9NFL1_DROME Eukaryotic translation initiation factor 5B OS=Drosophila melanogaster OX=7227 GN=eIF5B PE=1 SV=1
5	O60841	0.0	2435	1220	1.000	1.000	IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4
6	P39730	0.0	634	1002	0.258	0.314	IF2P_YEAST Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUN12 PE=1 SV=2
7	Q05D44	0.0	1783	1216	0.903	0.906	IF2P_MOUSE Eukaryotic translation initiation factor 5B OS=Mus musculus OX=10090 GN=Eif5b PE=1 SV=2
8	Q10251	0.0	664	1079	0.267	0.302	IF2P_SCHPO Eukaryotic translation initiation factor 5B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC56F8.03 PE=1 SV=1
9	Q4WK23	0.0	636	1068	0.258	0.295	Q4WK23_ASPFU Eukaryotic translation initiation factor 5B OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G03970 PE=3 SV=1
10	Q586X2	0.0	577	833	0.261	0.383	Q586X2_TRYB2 Translation initiation factor IF-2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.240 PE=3 SV=1
11	Q5A782	0.0	630	1017	0.257	0.308	Q5A782_CANAL Eukaryotic translation initiation factor 5B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FUN12 PE=3 SV=1
12	Q8N5A0	0.0	2430	1220	0.998	0.998	Q8N5A0_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=1
13	Q9NJH7	0.0	946	1144	0.355	0.378	Q9NJH7_DROME Eukaryotic translation initiation factor 5B OS=Drosophila melanogaster OX=7227 GN=eIF5B PE=2 SV=1
14	Q9VZP5	0.0	948	1144	0.355	0.378	Q9VZP5_DROME Eukaryotic translation initiation factor 5B OS=Drosophila melanogaster OX=7227 GN=eIF5B PE=1 SV=2
15	O59683	5.71e-29	127	686	0.108	0.192	IF2M_SCHPO Translation initiation factor IF-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.15c PE=3 SV=1
16	Q9W6Q4	1.63e-28	125	655	0.070	0.130	Q9W6Q4_CHICK Initiation of translation factor 2 (Fragment) OS=Gallus gallus OX=9031 GN=cIF2 PE=2 SV=1
17	P9WKK1	3.45e-27	122	900	0.048	0.064	IF2_MYCTU Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=infB PE=1 SV=1
18	P0A705	8.88e-27	120	890	0.127	0.174	IF2_ECOLI Translation initiation factor IF-2 OS=Escherichia coli (strain K12) OX=83333 GN=infB PE=1 SV=1
19	Q9HV55	1.27e-25	117	840	0.072	0.105	IF2_PSEAE Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=infB PE=1 SV=1
20	P46198	2.70e-23	109	727	0.047	0.078	IF2M_BOVIN Translation initiation factor IF-2, mitochondrial OS=Bos taurus OX=9913 GN=MTIF2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03029 ATP_bind_1	44	15.3	Conserved hypothetical ATP binding protein
2	PF00009 GTP_EFTU	3.8e-32	122.9	Elongation factor Tu GTP binding domain
3	PF03144 GTP_EFTU_D2	3.5e-06	38.6	Elongation factor Tu domain 2
4	PF14578 GTP_EFTU_D4	3.7e-12	57.3	Elongation factor Tu domain 4
5	PF11987 IF-2	5.5e-17	73.2	Translation-initiation factor 2
6	PF01926 MMR_HSR1	0.018	26.6	50S ribosome-binding GTPase
7	PF08477 Roc	2.3	19.9	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419449	0.998	Eukaryotic translation initiation factor 1
2	9606.ENSP00000358140	0.995	Eukaryotic translation initiation factor 3 subunit A
3	9606.ENSP00000364119	0.986	Eukaryotic translation initiation factor 2 subunit 2
4	9606.ENSP00000368927	0.983	Eukaryotic translation initiation factor 1A, X-chromosomal
5	9606.ENSP00000253108	0.979	Eukaryotic translation initiation factor 3 subunit G
6	9606.ENSP00000354125	0.979	Eukaryotic translation initiation factor 3 subunit B
7	9606.ENSP00000262584	0.976	60S ribosomal protein L8
8	9606.ENSP00000278572	0.976	40S ribosomal protein S3
9	9606.ENSP00000296674	0.976	40S ribosomal protein S23
10	9606.ENSP00000351407	0.976	Aryl hydrocarbon receptor nuclear translocator
11	9606.ENSP00000472985	0.976	Ribosomal protein S5
12	9606.ENSP00000332604	0.974	Eukaryotic translation initiation factor 3 subunit C
13	9606.ENSP00000359345	0.971	60S ribosomal protein L5
14	9606.ENSP00000400467	0.970	L ribosomal proteins
15	9606.ENSP00000420311	0.970	Ribosomal protein L23
16	9606.ENSP00000216554	0.968	Eukaryotic translation initiation factor 5
17	9606.ENSP00000369757	0.968	40S ribosomal protein S6
18	9606.ENSP00000467466	0.968	Ribosomal protein S15
19	9606.ENSP00000230050	0.967	Ribosomal protein S12
20	9606.ENSP00000270625	0.966	Ribosomal protein S11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.996	nucleic acid binding
GO:0003723	0.991	RNA binding
GO:0008135	0.981	translation factor activity, RNA binding
GO:0003743	0.965	translation initiation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051246	0.986	regulation of protein metabolic process
GO:0006417	0.976	regulation of translation
GO:0006446	0.960	regulation of translational initiation
GO:0009987	0.793	cellular process
GO:0044238	0.788	primary metabolic process
GO:0071704	0.781	organic substance metabolic process
GO:0044237	0.779	cellular metabolic process
GO:0006807	0.769	nitrogen compound metabolic process
GO:0043170	0.740	macromolecule metabolic process
GO:0034641	0.696	cellular nitrogen compound metabolic process
GO:1901564	0.564	organonitrogen compound metabolic process
GO:0010467	0.562	gene expression
GO:0044271	0.530	cellular nitrogen compound biosynthetic process
GO:0044260	0.523	cellular macromolecule metabolic process
GO:0019538	0.522	protein metabolic process
GO:1901576	0.504	organic substance biosynthetic process
GO:0043043	0.485	peptide biosynthetic process
GO:0009059	0.481	macromolecule biosynthetic process
GO:0006412	0.464	translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.672	organelle
GO:0043229	0.588	intracellular organelle
GO:0043227	0.567	membrane-bounded organelle
GO:0043233	0.505	organelle lumen
GO:0070013	0.504	intracellular organelle lumen
GO:0016020	0.488	membrane
GO:0005634	0.446	nucleus
GO:0043232	0.413	intracellular non-membrane-bounded organelle
GO:0032991	0.333	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]