StarFunc result for job id O60858

User Input

>input (407 residues)
MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKE
TSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATR
GEHTKHVFCSIEDAYAQERDAFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSD
KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFK
DVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
QDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGCLSNFSSYLTK
TADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60858	1.000	1.000	1.145E-68	407	1.000	1.000	O60858.pdb.gz	TRI13_HUMAN E3 ubiquitin-protein ligase TRIM13 OS=Homo sapiens OX=9606 GN=TRIM13 PE=1 SV=2
2	AFDB:Q9CYB0	0.484	0.484	4.616E-59	407	0.889	0.889	Q9CYB0.pdb.gz	TRI13_MOUSE E3 ubiquitin-protein ligase TRIM13 OS=Mus musculus OX=10090 GN=Trim13 PE=2 SV=1
3	AFDB:Q8IWR1	0.439	0.443	7.982E-24	403	0.280	0.283	Q8IWR1.pdb.gz	TRI59_HUMAN Tripartite motif-containing protein 59 OS=Homo sapiens OX=9606 GN=TRIM59 PE=1 SV=1
4	AFDB:Q922Y2	0.477	0.482	2.090E-22	403	0.312	0.315	Q922Y2.pdb.gz	TRI59_MOUSE Tripartite motif-containing protein 59 OS=Mus musculus OX=10090 GN=Trim59 PE=1 SV=2
5	AFDB:Q9BYV6	0.328	0.257	2.476E-16	548	0.170	0.126	Q9BYV6.pdb.gz	TRI55_HUMAN Tripartite motif-containing protein 55 OS=Homo sapiens OX=9606 GN=TRIM55 PE=1 SV=2
6	AFDB:Q9ERP3	0.269	0.292	3.168E-16	366	0.172	0.191	Q9ERP3.pdb.gz	TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus OX=10090 GN=Trim54 PE=1 SV=1
7	AFDB:G3X8Y1	0.330	0.257	9.030E-16	545	0.167	0.125	G3X8Y1.pdb.gz	G3X8Y1_MOUSE Tripartite motif-containing 55 OS=Mus musculus OX=10090 GN=Trim55 PE=1 SV=1
8	AFDB:O70583	0.270	0.173	2.275E-15	680	0.192	0.115	O70583.pdb.gz	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
9	AFDB:Q810I2	0.248	0.214	4.481E-15	483	0.152	0.128	Q810I2.pdb.gz	TRI50_MOUSE E3 ubiquitin-protein ligase TRIM50 OS=Mus musculus OX=10090 GN=Trim50 PE=1 SV=1
10	AFDB:Q923T7	0.217	0.183	5.068E-15	510	0.170	0.135	Q923T7.pdb.gz	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
11	PDB:7z36B	0.310	0.286	1.480E-9	446	0.123	0.112	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
12	PDB:4tn3B	0.266	0.293	8.055E-5	362	0.091	0.102	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
13	PDB:5dkaA	0.122	0.462	8.371E-4	96	0.049	0.208	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:4r8pL	0.155	0.242	1.007E-3	254	0.054	0.087	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:7jzvA	0.169	0.267	7.691E-3	253	0.064	0.103	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
16	PDB:5gm6a	0.133	0.403	9.841E-3	123	0.047	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:7qcdC	0.132	0.186	2.983E-2	267	0.039	0.060	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:7oikA	0.137	0.014	7.993E-2	4426	0.047	0.004	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
19	PDB:2c2lA	0.154	0.219	1.023E-1	281	0.029	0.043	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
20	PDB:3m62A	0.156	0.068	1.230E-1	955	0.032	0.014	3m62A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60858	0.0	837	407	1.000	1.000	TRI13_HUMAN E3 ubiquitin-protein ligase TRIM13 OS=Homo sapiens OX=9606 GN=TRIM13 PE=1 SV=2
2	Q9CYB0	0.0	743	407	0.889	0.889	TRI13_MOUSE E3 ubiquitin-protein ligase TRIM13 OS=Mus musculus OX=10090 GN=Trim13 PE=2 SV=1
3	Q922Y2	7.84e-65	214	403	0.273	0.275	TRI59_MOUSE Tripartite motif-containing protein 59 OS=Mus musculus OX=10090 GN=Trim59 PE=1 SV=2
4	Q8IWR1	1.33e-61	206	403	0.258	0.261	TRI59_HUMAN Tripartite motif-containing protein 59 OS=Homo sapiens OX=9606 GN=TRIM59 PE=1 SV=1
5	Q9C037	4.26e-21	97.4	500	0.120	0.098	TRIM4_HUMAN E3 ubiquitin-protein ligase TRIM4 OS=Homo sapiens OX=9606 GN=TRIM4 PE=1 SV=2
6	Q86XT4	3.44e-20	94.4	487	0.167	0.140	TRI50_HUMAN E3 ubiquitin-protein ligase TRIM50 OS=Homo sapiens OX=9606 GN=TRIM50 PE=1 SV=2
7	Q9ERP3	1.03e-19	92.0	366	0.194	0.216	TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus OX=10090 GN=Trim54 PE=1 SV=1
8	Q969Q1	1.11e-19	91.7	353	0.192	0.221	TRI63_HUMAN E3 ubiquitin-protein ligase TRIM63 OS=Homo sapiens OX=9606 GN=TRIM63 PE=1 SV=1
9	Q6AZZ1	1.77e-19	92.4	485	0.192	0.161	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
10	Q91Z63	2.85e-19	90.5	351	0.179	0.208	TRI63_RAT E3 ubiquitin-protein ligase TRIM63 OS=Rattus norvegicus OX=10116 GN=Trim63 PE=2 SV=1
11	Q9BYV2	5.54e-19	89.7	358	0.192	0.218	TRI54_HUMAN Tripartite motif-containing protein 54 OS=Homo sapiens OX=9606 GN=TRIM54 PE=1 SV=3
12	Q38HM4	8.03e-19	89.4	350	0.179	0.209	TRI63_MOUSE E3 ubiquitin-protein ligase TRIM63 OS=Mus musculus OX=10090 GN=Trim63 PE=1 SV=1
13	Q6ZMU5	1.51e-18	89.4	477	0.167	0.143	TRI72_HUMAN Tripartite motif-containing protein 72 OS=Homo sapiens OX=9606 GN=TRIM72 PE=1 SV=2
14	Q1XH17	1.60e-18	89.4	477	0.182	0.155	TRI72_MOUSE Tripartite motif-containing protein 72 OS=Mus musculus OX=10090 GN=Trim72 PE=1 SV=1
15	Q80V85	3.31e-18	88.6	475	0.199	0.171	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
16	Q9BVG3	6.35e-18	87.8	475	0.199	0.171	TRI62_HUMAN E3 ubiquitin-protein ligase TRIM62 OS=Homo sapiens OX=9606 GN=TRIM62 PE=1 SV=1
17	Q5C8U3	6.61e-18	87.8	515	0.165	0.130	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
18	Q9BYV6	2.31e-17	86.3	548	0.194	0.144	TRI55_HUMAN Tripartite motif-containing protein 55 OS=Homo sapiens OX=9606 GN=TRIM55 PE=1 SV=2
19	I3L0H3	2.50e-17	83.2	249	0.150	0.245	I3L0H3_HUMAN Tripartite motif containing 73 OS=Homo sapiens OX=9606 GN=TRIM73 PE=4 SV=1
20	Q86UV7	2.57e-17	83.2	250	0.150	0.244	TRI73_HUMAN Tripartite motif-containing protein 73 OS=Homo sapiens OX=9606 GN=TRIM73 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08112 ATP-synt_E_2	3.5e+02	12.9	ATP synthase epsilon subunit
2	PF02028 BCCT	6e+02	10.3	BCCT, betaine/carnitine/choline family transporter
3	PF00643 zf-B_box	0.0005	31.5	B-box zinc finger
4	PF00097 zf-C3HC4	0.0002	32.5	Zinc finger, C3HC4 type (RING finger)
5	PF13923 zf-C3HC4_2	0.95	20.7	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	0.002	29.2	Zinc finger, C3HC4 type (RING finger)
7	PF15227 zf-C3HC4_4	0.14	23.6	zinc finger of C3HC4-type, RING
8	PF13639 zf-RING_2	0.0073	28.0	Ring finger domain
9	PF14570 zf-RING_4	1.4e+02	13.7	RING/Ubox like zinc-binding domain
10	PF14634 zf-RING_5	0.0034	28.6	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	2e-06	39.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348299

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374455	0.933	Sequestosome-1
2	9606.ENSP00000324191	0.909	Potassium channel regulatory protein
3	9606.ENSP00000272317	0.904	Ubiquitin-40S ribosomal protein S27a
4	9606.ENSP00000304697	0.904	Polyubiquitin-B
5	9606.ENSP00000441543	0.904	Polyubiquitin-C
6	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
7	9606.ENSP00000468411	0.855	Gamma-secretase subunit PEN-2
8	9606.ENSP00000476815	0.815	Graves disease carrier protein
9	9606.ENSP00000367422	0.813	Leukemia-associated protein 1
10	9606.ENSP00000354774	0.810	SPRY domain containing 7
11	9606.ENSP00000263642	0.751	Interferon-induced helicase C domain-containing protein 1
12	9606.ENSP00000328169	0.736	Protein jagged-2
13	9606.ENSP00000369027	0.684	Short transient receptor potential channel 4
14	9606.ENSP00000384092	0.681	Pro-opiomelanocortin
15	9606.ENSP00000440185	0.681	Proenkephalin-B
16	9606.ENSP00000337053	0.663	Protein sel-1 homolog 1
17	9606.ENSP00000394624	0.656	Mu-type opioid receptor
18	9606.ENSP00000342056	0.650	Citrate synthase, mitochondrial
19	9606.ENSP00000158771	0.641	Derlin-2
20	9606.ENSP00000318165	0.640	Protein OS-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0009987	0.984	cellular process
GO:0050896	0.983	response to stimulus
GO:0044238	0.983	primary metabolic process
GO:0006807	0.965	nitrogen compound metabolic process
GO:1903506	0.956	regulation of nucleic acid-templated transcription
GO:0044237	0.954	cellular metabolic process
GO:0048522	0.939	positive regulation of cellular process
GO:0006508	0.925	proteolysis
GO:0006950	0.921	response to stress
GO:0006355	0.907	regulation of DNA-templated transcription
GO:0051716	0.904	cellular response to stimulus
GO:0048583	0.901	regulation of response to stimulus
GO:0048519	0.896	negative regulation of biological process
GO:0044260	0.888	cellular macromolecule metabolic process
GO:0009893	0.880	positive regulation of metabolic process
GO:0030163	0.876	protein catabolic process
GO:0036211	0.852	protein modification process
GO:0002376	0.843	immune system process
GO:0050792	0.818	regulation of viral process
GO:0048584	0.813	positive regulation of response to stimulus
GO:0033554	0.813	cellular response to stress
GO:0044248	0.812	cellular catabolic process
GO:0042221	0.796	response to chemical
GO:0006955	0.795	immune response
GO:0043122	0.786	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051603	0.786	proteolysis involved in protein catabolic process
GO:0098542	0.774	defense response to other organism
GO:0031325	0.768	positive regulation of cellular metabolic process
GO:0010033	0.762	response to organic substance
GO:0048523	0.749	negative regulation of cellular process
GO:0023056	0.749	positive regulation of signaling
GO:0010647	0.704	positive regulation of cell communication
GO:0065009	0.680	regulation of molecular function
GO:0045087	0.678	innate immune response
GO:0070647	0.676	protein modification by small protein conjugation or removal
GO:0048525	0.675	negative regulation of viral process
GO:0006511	0.674	ubiquitin-dependent protein catabolic process
GO:0010648	0.554	negative regulation of cell communication
GO:0023057	0.551	negative regulation of signaling
GO:0010498	0.533	proteasomal protein catabolic process
GO:0009967	0.481	positive regulation of signal transduction
GO:0043161	0.481	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0032446	0.477	protein modification by small protein conjugation
GO:0044093	0.467	positive regulation of molecular function
GO:0009894	0.457	regulation of catabolic process
GO:1902533	0.457	positive regulation of intracellular signal transduction
GO:0051091	0.436	positive regulation of DNA-binding transcription factor activity
GO:1901698	0.418	response to nitrogen compound
GO:0031329	0.401	regulation of cellular catabolic process
GO:0051092	0.384	positive regulation of NF-kappaB transcription factor activity
GO:0043123	0.362	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010243	0.353	response to organonitrogen compound
GO:0009896	0.338	positive regulation of catabolic process
GO:0036503	0.334	ERAD pathway
GO:0031331	0.333	positive regulation of cellular catabolic process
GO:0016567	0.325	protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0012505	0.996	endomembrane system
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0016020	0.972	membrane
GO:0031090	0.923	organelle membrane
GO:0005783	0.918	endoplasmic reticulum
GO:0042175	0.832	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.828	organelle subcompartment
GO:0005789	0.805	endoplasmic reticulum membrane
GO:0048471	0.328	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]