StarFunc result for job id O60869

User Input

>input (148 residues)
MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAK
LDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQV
LGKIERAIGLKLRGKDIGKPIEKGPRAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60869	1.000	1.000	1.111E-26	148	1.000	1.000	O60869.pdb.gz	EDF1_HUMAN Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1 PE=1 SV=1
2	AFDB:Q9XZ03	0.893	0.911	3.230E-19	145	0.628	0.641	Q9XZ03.pdb.gz	Q9XZ03_DROME Multiprotein Bridging Factor 1 OS=Drosophila melanogaster OX=7227 GN=mbf1 PE=1 SV=1
3	AFDB:Q9LXT3	0.780	0.811	4.751E-15	142	0.486	0.507	Q9LXT3.pdb.gz	MBF1B_ARATH Multiprotein-bridging factor 1b OS=Arabidopsis thaliana OX=3702 GN=MBF1B PE=1 SV=1
4	AFDB:O14467	0.742	0.729	1.143E-14	151	0.453	0.444	O14467.pdb.gz	MBF1_YEAST Multiprotein-bridging factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MBF1 PE=1 SV=2
5	AFDB:O94700	0.775	0.775	2.279E-14	148	0.507	0.507	O94700.pdb.gz	MBF1_SCHPO Multiprotein-bridging factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mbf1 PE=3 SV=1
6	AFDB:Q6FJN0	0.735	0.723	4.008E-14	151	0.480	0.470	Q6FJN0.pdb.gz	MBF1_CANGA Multiprotein-bridging factor 1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=MBF1 PE=3 SV=1
7	AFDB:Q9LV58	0.796	0.796	5.946E-13	148	0.405	0.405	Q9LV58.pdb.gz	MBF1C_ARATH Multiprotein-bridging factor 1c OS=Arabidopsis thaliana OX=3702 GN=MBF1C PE=1 SV=1
8	AFDB:Q388C5	0.725	0.677	4.797E-11	160	0.385	0.356	Q388C5.pdb.gz	Q388C5_TRYB2 HTH cro/C1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1840 PE=4 SV=1
9	AFDB:Q8II81	0.690	0.747	5.201E-10	136	0.331	0.360	Q8II81.pdb.gz	Q8II81_PLAF7 Multiprotein-bridging factor 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1128200 PE=4 SV=1
10	PDB:3f51A	0.369	0.566	1.245E-4	94	0.101	0.160	3f51A.pdb.gz
11	AFDB:Q9I551	0.378	0.246	4.803E-4	237	0.122	0.076	Q9I551.pdb.gz	Q9I551_PSEAE Probable transcriptional regulator OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0906 PE=4 SV=1
12	PDB:1b0nA	0.360	0.510	9.265E-4	103	0.095	0.136	1b0nA.pdb.gz	An evolutionary link between sporulation and prophage induction in the structure of a repressor:anti-repressor complex.
13	PDB:4j1xC	0.361	0.279	1.437E-3	195	0.095	0.072	4j1xC.pdb.gz	Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
14	PDB:3dnvB	0.371	0.717	5.038E-3	71	0.108	0.225	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
15	PDB:6b9tD	0.381	0.134	1.004E-2	453	0.101	0.033	6b9tD.pdb.gz	Structural basis for methylphosphonate biosynthesis.
16	PDB:6cf1B	0.350	0.533	1.291E-2	94	0.068	0.106	6cf1B.pdb.gz
17	PDB:4o8bA	0.351	0.504	1.558E-2	101	0.074	0.109	4o8bA.pdb.gz
18	PDB:5jaaA	0.321	0.457	1.881E-2	102	0.101	0.147	5jaaA.pdb.gz
19	PDB:2grmA	0.348	0.172	7.020E-2	315	0.095	0.044	2grmA.pdb.gz	Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
20	PDB:4yarA	0.326	0.124	1.235E-1	429	0.101	0.035	4yarA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60869	1.58e-104	296	148	1.000	1.000	EDF1_HUMAN Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1 PE=1 SV=1
2	Q9XZ03	1.23e-62	190	145	0.615	0.628	Q9XZ03_DROME Multiprotein Bridging Factor 1 OS=Drosophila melanogaster OX=7227 GN=mbf1 PE=1 SV=1
3	M9PFR6	9.44e-62	189	188	0.615	0.484	M9PFR6_DROME Multiprotein bridging factor 1, isoform E OS=Drosophila melanogaster OX=7227 GN=mbf1 PE=1 SV=1
4	Q9LXT3	4.82e-41	135	142	0.493	0.514	MBF1B_ARATH Multiprotein-bridging factor 1b OS=Arabidopsis thaliana OX=3702 GN=MBF1B PE=1 SV=1
5	O94700	4.20e-39	131	148	0.507	0.507	MBF1_SCHPO Multiprotein-bridging factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mbf1 PE=3 SV=1
6	Q9SJI8	2.98e-38	129	142	0.480	0.500	MBF1A_ARATH Multiprotein-bridging factor 1a OS=Arabidopsis thaliana OX=3702 GN=MBF1A PE=2 SV=1
7	Q6FJN0	9.05e-37	125	151	0.486	0.477	MBF1_CANGA Multiprotein-bridging factor 1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=MBF1 PE=3 SV=1
8	O14467	1.55e-35	122	151	0.439	0.430	MBF1_YEAST Multiprotein-bridging factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MBF1 PE=1 SV=2
9	Q9LV58	6.67e-29	105	148	0.432	0.432	MBF1C_ARATH Multiprotein-bridging factor 1c OS=Arabidopsis thaliana OX=3702 GN=MBF1C PE=1 SV=1
10	Q8II81	5.35e-22	87.0	136	0.318	0.346	Q8II81_PLAF7 Multiprotein-bridging factor 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1128200 PE=4 SV=1
11	Q388C5	8.14e-17	74.3	160	0.318	0.294	Q388C5_TRYB2 HTH cro/C1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1840 PE=4 SV=1
12	Q384L3	1.3	31.2	573	0.095	0.024	Q384L3_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0480 PE=4 SV=1
13	A0A8I6A794	2.4	30.4	5475	0.209	0.006	A0A8I6A794_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
14	Q6P2Q0	2.5	30.4	769	0.149	0.029	Q6P2Q0_HUMAN ABCB9 protein OS=Homo sapiens OX=9606 GN=ABCB9 PE=2 SV=1
15	Q9NP78	2.5	30.4	766	0.149	0.029	ABCB9_HUMAN ABC-type oligopeptide transporter ABCB9 OS=Homo sapiens OX=9606 GN=ABCB9 PE=1 SV=1
16	O02057	4.0	29.6	429	0.149	0.051	O02057_CAEEL EamA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=B0041.5 PE=4 SV=2
17	Q9BRG1	7.5	28.5	176	0.182	0.153	VPS25_HUMAN Vacuolar protein-sorting-associated protein 25 OS=Homo sapiens OX=9606 GN=VPS25 PE=1 SV=1
18	Q01852	8.5	28.9	431	0.176	0.060	TIM44_YEAST Mitochondrial import inner membrane translocase subunit TIM44 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM44 PE=1 SV=1
19	Q9QYJ4	8.5	28.9	762	0.149	0.029	ABCB9_RAT ABC-type oligopeptide transporter ABCB9 OS=Rattus norvegicus OX=10116 GN=Abcb9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19843 DUF6318	3.2e+02	12.9	Family of unknown function (DUF6318)
2	PF12844 HTH_19	2.5e+02	13.1	Helix-turn-helix domain
3	PF01381 HTH_3	2.8e-09	48.2	Helix-turn-helix
4	PF13560 HTH_31	0.16	23.6	Helix-turn-helix domain
5	PF08523 MBF1	3e-22	90.1	Multiprotein bridging factor 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008592508.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008577314.1	0.849	40S ribosomal protein S23
2	482537.XP_008578211.1	0.780	Ubiquitin-like protein fubi and ribosomal protein S30
3	482537.XP_008588511.1	0.778	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 6 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
4	482537.XP_008568356.1	0.759	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons
5	482537.XP_008583219.1	0.748	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
6	482537.XP_008565651.1	0.742	Stress-induced-phosphoprotein 1
7	482537.XP_008569598.1	0.742	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008587845.1	0.734	Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase
9	482537.XP_008583262.1	0.694	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
10	482537.XP_008589264.1	0.688	NSFL1 cofactor p47
11	482537.XP_008579732.1	0.669	Guanine nucleotide-binding protein subunit beta-2-like 1
12	482537.XP_008570141.1	0.658	alanyl-tRNA editing protein Aarsd1-like
13	482537.XP_008563276.1	0.654	Prostaglandin E synthase 3-like
14	482537.XP_008573714.1	0.654	Prostaglandin E synthase 3
15	482537.XP_008568237.1	0.640	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
16	482537.XP_008570862.1	0.640	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 65 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
17	482537.XP_008577108.1	0.640	Heat shock protein HSP 90-alpha
18	482537.XP_008580382.1	0.640	40S ribosomal protein S16
19	482537.XP_008561388.1	0.638	TATA-box-binding protein
20	482537.XP_008574902.1	0.638	TATA box-binding protein-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0003723	1.000	RNA binding
GO:0001091	0.996	RNA polymerase II general transcription initiation factor binding
GO:0044877	0.857	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0010468	0.989	regulation of gene expression
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031326	0.984	regulation of cellular biosynthetic process
GO:0019219	0.983	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.980	positive regulation of biological process
GO:0031328	0.973	positive regulation of cellular biosynthetic process
GO:0010556	0.960	regulation of macromolecule biosynthetic process
GO:0051252	0.959	regulation of RNA metabolic process
GO:0009987	0.952	cellular process
GO:0006355	0.952	regulation of DNA-templated transcription
GO:0051173	0.938	positive regulation of nitrogen compound metabolic process
GO:0010604	0.932	positive regulation of macromolecule metabolic process
GO:0045935	0.927	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.921	positive regulation of RNA metabolic process
GO:0010557	0.917	positive regulation of macromolecule biosynthetic process
GO:0045893	0.910	positive regulation of DNA-templated transcription
GO:0032502	0.475	developmental process
GO:0048856	0.455	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.996	nucleoplasm
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005730	0.928	nucleolus
GO:0032991	0.406	protein-containing complex
GO:0016020	0.367	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]