StarFunc result for job id O60879

User Input

>input (1101 residues)
MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRIT
SFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLN
EEKKAPLRNKDFTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDEKLL
NCLESLRVSLTSNPVSWVNNFGHEGLGLLLDELEKLLDKKQQENIDKKNQYKLIQCLKAF
MNNKFGLQRILGDERSLLLLARAIDPKQPNMMTEIVKILSAICIVGEENILDKLLGAITT
AAERNNRERFSPIVEGLENQEALQLQVACMQFINALVTSPYELDFRIHLRNEFLRSGLKT
MLPDLKEKENDELDIQLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTA
AENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLHCSGMDPDFKYRQRLDIDLTHL
IDSCVNKAKVEESEQKAAEFSKKFDEEFTARQEAQAELQKRDEKIKELEAEIQQLRTQAQ
VLSSSSGIPGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLF
GGPPPPPPLGGVPPPPGISLNLPYGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRV
KEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIF
LGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQF
GVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLV
GNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEH
VESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTSFTKTAREQYEK
LSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTR
RAKLAKEKAEQEKLERQKKKKQLIDINKEGDETGVMDNLLEALQSGAAFRDRRKRIPRNP
DNRRVPLERSRSRHNGAISSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60879	1.000	1.000	0.000	1101	1.000	1.000	O60879.pdb.gz	DIAP2_HUMAN Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1
2	AFDB:O70566	0.598	0.600	0.000	1098	0.837	0.839	O70566.pdb.gz	DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2
3	AFDB:F1RCU7	0.639	0.652	3.522E-90	1077	0.715	0.731	F1RCU7.pdb.gz
4	AFDB:F1LVW7	0.686	0.648	3.239E-83	1172	0.550	0.517	F1LVW7.pdb.gz	DIAP3_RAT Protein diaphanous homolog 3 OS=Rattus norvegicus OX=10116 GN=Diaph3 PE=1 SV=4
5	AFDB:P48608	0.437	0.440	1.540E-55	1091	0.375	0.379	P48608.pdb.gz	DIA_DROME Protein diaphanous OS=Drosophila melanogaster OX=7227 GN=dia PE=2 SV=2
6	AFDB:Q80U19	0.444	0.439	6.543E-40	1115	0.250	0.247	Q80U19.pdb.gz	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
7	AFDB:Q54WH2	0.344	0.312	4.943E-38	1218	0.262	0.236	Q54WH2.pdb.gz	FORA_DICDI Formin-A OS=Dictyostelium discoideum OX=44689 GN=forA PE=1 SV=1
8	AFDB:Q7JP75	0.362	0.281	9.494E-38	1437	0.245	0.188	Q7JP75.pdb.gz	Q7JP75_CAEEL WAPL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cyk-1 PE=1 SV=2
9	AFDB:Q5TJ56	0.346	0.315	1.565E-33	1220	0.251	0.226	Q5TJ56.pdb.gz	FORF_DICDI Formin-F OS=Dictyostelium discoideum OX=44689 GN=forF PE=1 SV=1
10	AFDB:Q5TJ57	0.286	0.209	2.312E-32	1561	0.236	0.167	Q5TJ57.pdb.gz	FORE_DICDI Formin-E OS=Dictyostelium discoideum OX=44689 GN=forE PE=1 SV=1
11	PDB:4a0cA	0.125	0.122	1.371E-2	1155	0.104	0.099	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
12	PDB:1wa5B	0.111	0.204	1.979E-2	466	0.046	0.109	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
13	PDB:7sn8D	0.088	0.154	2.237E-2	399	0.045	0.125	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
14	PDB:3wyfC	0.110	0.116	3.650E-2	1040	0.097	0.103	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
15	PDB:3zkvA	0.127	0.152	6.204E-2	873	0.090	0.113	3zkvA.pdb.gz
16	PDB:4ct7B	0.147	0.496	7.924E-2	269	0.029	0.119	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
17	PDB:1qbkB	0.115	0.138	1.012E-1	880	0.035	0.043	1qbkB.pdb.gz	Structure of the nuclear transport complex karyopherin-beta2-Ran x GppNHp.
18	PDB:7qfwA	0.099	0.120	1.054E-1	823	0.049	0.066	7qfwA.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
19	PDB:6v8oN	0.106	0.225	1.192E-1	412	0.029	0.078	6v8oN.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
20	PDB:3tpoA	0.168	0.386	1.461E-1	438	0.036	0.091	3tpoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LVW7	0.0	581	1172	0.250	0.235	DIAP3_RAT Protein diaphanous homolog 3 OS=Rattus norvegicus OX=10116 GN=Diaph3 PE=1 SV=4
2	O08808	0.0	583	1255	0.268	0.235	DIAP1_MOUSE Protein diaphanous homolog 1 OS=Mus musculus OX=10090 GN=Diaph1 PE=1 SV=1
3	O60610	0.0	593	1272	0.273	0.237	DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2
4	O60879	0.0	2251	1101	1.000	1.000	DIAP2_HUMAN Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1
5	O70566	0.0	839	1098	0.366	0.367	DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2
6	Q9Z207	0.0	1137	1171	0.549	0.516	DIAP3_MOUSE Protein diaphanous homolog 3 OS=Mus musculus OX=10090 GN=Diaph3 PE=1 SV=1
7	Q9NSV4	9.03e-173	541	1193	0.256	0.236	DIAP3_HUMAN Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4
8	F1RMT5	2.76e-140	446	850	0.238	0.308	F1RMT5_PIG Diaphanous related formin 1 OS=Sus scrofa OX=9823 GN=DIAPH1 PE=1 SV=5
9	P48608	2.66e-106	360	1091	0.182	0.183	DIA_DROME Protein diaphanous OS=Drosophila melanogaster OX=7227 GN=dia PE=2 SV=2
10	Q7YZA4	3.53e-63	236	1114	0.243	0.241	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1
11	Q8IRY0	8.26e-63	235	1153	0.243	0.232	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
12	M9MSM5	1.61e-62	236	1463	0.243	0.183	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
13	Q8MT16	4.47e-62	233	1114	0.243	0.241	Q8MT16_DROME RH61354p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
14	Q5BII2	1.29e-55	212	1011	0.213	0.232	Q5BII2_DROME RE67944p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
15	Q9W5A4	2.52e-55	211	979	0.239	0.269	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2
16	Q9Y4D1	1.31e-49	194	1078	0.137	0.140	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
17	A0A1D5P556	1.37e-49	194	1075	0.145	0.149	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
18	B3DJI0	7.05e-49	191	1069	0.136	0.140	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
19	Q5RHJ3	3.82e-48	189	1079	0.136	0.139	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
20	Q54WH2	1.88e-47	187	1218	0.124	0.112	FORA_DICDI Formin-A OS=Dictyostelium discoideum OX=44689 GN=forA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06345 Drf_DAD	1.1	20.4	DRF Autoregulatory Domain
2	PF06346 Drf_FH1	4.3e+02	12.1	Formin Homology Region 1
3	PF06367 Drf_FH3	2.5e-56	202.0	Diaphanous FH3 Domain
4	PF06371 Drf_GBD	2.2e-50	182.4	Diaphanous GTPase-binding Domain
5	PF20570 DUF6779	26	16.9	Domain of unknown function (DUF6779)
6	PF02181 FH2	5.1e-108	373.1	Formin Homology 2 Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321348

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.929	Transforming protein RhoA
2	9606.ENSP00000308576	0.911	Rho-related GTP-binding protein RhoD
3	9606.ENSP00000225655	0.867	Profilin-1
4	9606.ENSP00000381565	0.866	Protein diaphanous homolog 1
5	9606.ENSP00000322170	0.861	Profilin-4
6	9606.ENSP00000351379	0.838	Profilin-3
7	9606.ENSP00000262753	0.777	Protein POF1B
8	9606.ENSP00000362680	0.754	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000362260	0.744	Zinc finger protein 711
10	9606.ENSP00000383178	0.697	Protein diaphanous homolog 3
11	9606.ENSP00000383118	0.687	Cell division control protein 42 homolog
12	9606.ENSP00000362372	0.676	Bromodomain and WD repeat-containing protein 3
13	9606.ENSP00000362217	0.665	Dachshund homolog 2
14	9606.ENSP00000332756	0.642	Phospholipid-transporting ATPase IG
15	9606.ENSP00000359506	0.632	Synaptic functional regulator FMR1
16	9606.ENSP00000303777	0.622	Testis-expressed protein 13B
17	9606.ENSP00000339801	0.607	Iduronate 2-sulfatase
18	9606.ENSP00000333097	0.602	Factor in the germline alpha
19	9606.ENSP00000361173	0.590	Potassium voltage-gated channel subfamily E regulatory beta subunit 5
20	9606.ENSP00000427567	0.584	Microtubule-associated formin which regulates both actin and microtubule dynamics. Induces microtubule acetylation and stabilization and actin stress fiber formation . Regulates Golgi ribbon formation . Required for normal cilia assembly. Early in cilia assembly, may assist in the maturation and positioning of the centrosome/basal body, and once cilia assembly has initiated, may also promote cilia elongation by inhibiting disassembly

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0008092	0.560	cytoskeletal protein binding
GO:0003779	0.471	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0016043	0.985	cellular component organization
GO:0030036	0.980	actin cytoskeleton organization
GO:0097435	0.975	supramolecular fiber organization
GO:0007015	0.970	actin filament organization
GO:0050794	0.958	regulation of cellular process
GO:0032501	0.906	multicellular organismal process
GO:0051258	0.878	protein polymerization
GO:0048856	0.873	anatomical structure development
GO:0008154	0.834	actin polymerization or depolymerization
GO:0007275	0.792	multicellular organism development
GO:0051179	0.715	localization
GO:0051234	0.618	establishment of localization
GO:0048870	0.615	cell motility
GO:0030041	0.559	actin filament polymerization
GO:0000003	0.535	reproduction
GO:0016477	0.510	cell migration
GO:0022414	0.478	reproductive process
GO:0019953	0.464	sexual reproduction
GO:0048583	0.404	regulation of response to stimulus
GO:0010646	0.404	regulation of cell communication
GO:0023051	0.376	regulation of signaling
GO:0048609	0.366	multicellular organismal reproductive process
GO:0050896	0.312	response to stimulus
GO:0007276	0.312	gamete generation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.999	nucleus
GO:0070013	0.989	intracellular organelle lumen
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0031981	0.976	nuclear lumen
GO:0012505	0.958	endomembrane system
GO:0016020	0.717	membrane
GO:0005783	0.683	endoplasmic reticulum
GO:0005730	0.428	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]