StarFunc result for job id O60880

User Input

>input (128 residues)
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTE
TGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIRED
PDVCLKAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60880	1.000	1.000	1.097E-25	128	1.000	1.000	O60880.pdb.gz	SH21A_HUMAN SH2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=SH2D1A PE=1 SV=1
2	AFDB:O88890	0.811	0.824	1.710E-21	126	0.875	0.889	O88890.pdb.gz	SH21A_MOUSE SH2 domain-containing protein 1A OS=Mus musculus OX=10090 GN=Sh2d1a PE=1 SV=1
3	PDB:1ka6A	0.788	0.936	9.159E-20	107	0.836	1.000	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
4	AFDB:D7PF45	0.801	0.092	5.740E-14	1260	0.367	0.037	D7PF45.pdb.gz	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2
5	AFDB:O14796	0.818	0.794	7.822E-14	132	0.383	0.371	O14796.pdb.gz	SH21B_HUMAN SH2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=SH2D1B PE=1 SV=2
6	AFDB:Q45HK4	0.776	0.753	8.322E-14	132	0.359	0.348	Q45HK4.pdb.gz	SH21C_MOUSE SH2 domain-containing protein 1B2 OS=Mus musculus OX=10090 GN=Sh2d1b2 PE=1 SV=1
7	AFDB:W5U6G9	0.772	0.089	1.365E-13	1256	0.352	0.036	W5U6G9.pdb.gz	W5U6G9_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=inppl1a PE=2 SV=1
8	AFDB:Q9ES52	0.787	0.093	2.240E-13	1191	0.344	0.037	Q9ES52.pdb.gz	SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus OX=10090 GN=Inpp5d PE=1 SV=2
9	AFDB:O35324	0.807	0.783	3.247E-13	132	0.320	0.311	O35324.pdb.gz	SH21B_MOUSE SH2 domain-containing protein 1B OS=Mus musculus OX=10090 GN=Sh2d1b PE=1 SV=1
10	AFDB:Q92835	0.788	0.093	3.455E-13	1189	0.352	0.038	Q92835.pdb.gz	SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2
11	AFDB:E9QIN2	0.778	0.129	5.328E-13	835	0.359	0.055	E9QIN2.pdb.gz
12	PDB:4fl2A	0.662	0.166	1.781E-8	555	0.242	0.056	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:1k9aB	0.652	0.201	4.183E-7	441	0.227	0.066	1k9aB.pdb.gz
14	PDB:4k2rA	0.683	0.170	9.351E-7	551	0.211	0.049	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:4gwfA	0.650	0.179	2.091E-6	497	0.203	0.052	4gwfA.pdb.gz
16	PDB:5xzrA	0.599	0.163	4.130E-6	519	0.242	0.060	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
17	PDB:3ps5A	0.638	0.166	5.987E-6	529	0.227	0.055	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
18	PDB:1griA	0.600	0.381	1.045E-5	211	0.188	0.114	1griA.pdb.gz
19	PDB:2h8hA	0.658	0.212	1.112E-5	445	0.250	0.072	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
20	PDB:8dcxB	0.612	0.352	4.338E-5	236	0.211	0.114	8dcxB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60880	9.51e-93	265	128	1.000	1.000	SH21A_HUMAN SH2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=SH2D1A PE=1 SV=1
2	O88890	1.70e-77	226	126	0.875	0.889	SH21A_MOUSE SH2 domain-containing protein 1A OS=Mus musculus OX=10090 GN=Sh2d1a PE=1 SV=1
3	O14796	2.39e-30	107	132	0.375	0.364	SH21B_HUMAN SH2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=SH2D1B PE=1 SV=2
4	Q45HK4	2.01e-25	95.1	132	0.359	0.348	SH21C_MOUSE SH2 domain-containing protein 1B2 OS=Mus musculus OX=10090 GN=Sh2d1b2 PE=1 SV=1
5	A0A0C5AMM3	3.09e-24	98.6	1116	0.359	0.041	A0A0C5AMM3_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 PE=2 SV=1
6	W5UIG7	3.37e-24	98.6	1118	0.359	0.041	W5UIG7_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=Inpp5d PE=2 SV=1
7	O35324	1.15e-22	88.2	132	0.328	0.318	SH21B_MOUSE SH2 domain-containing protein 1B OS=Mus musculus OX=10090 GN=Sh2d1b PE=1 SV=1
8	Q9ES52	3.46e-22	92.8	1191	0.328	0.035	SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus OX=10090 GN=Inpp5d PE=1 SV=2
9	Q92835	4.85e-22	92.4	1189	0.336	0.036	SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2
10	P97573	8.69e-22	91.7	1190	0.320	0.034	SHIP1_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Inpp5d PE=1 SV=1
11	Q2I6J1	2.30e-19	84.7	1266	0.352	0.036	SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio OX=7955 GN=inppl1a PE=2 SV=2
12	A0A0C5A9Q6	5.25e-19	83.6	1283	0.336	0.034	A0A0C5A9Q6_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase (Fragment) OS=Ictalurus punctatus OX=7998 PE=2 SV=1
13	W5U6G9	5.30e-19	83.6	1256	0.336	0.034	W5U6G9_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=inppl1a PE=2 SV=1
14	D7PF45	1.05e-17	80.1	1260	0.344	0.035	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2
15	Q9WVR3	2.49e-17	79.0	1257	0.344	0.035	SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Inppl1 PE=1 SV=1
16	Q6P549	2.61e-17	79.0	1257	0.344	0.035	SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus OX=10090 GN=Inppl1 PE=1 SV=1
17	O15357	7.67e-17	77.4	1258	0.336	0.034	SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2
18	P00522	3.79e-12	63.9	1620	0.273	0.022	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
19	G5ECJ6	3.88e-12	63.9	539	0.250	0.059	CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans OX=6239 GN=csk-1 PE=1 SV=1
20	Q2PYT4	6.93e-11	60.5	1143	0.258	0.029	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	4.4e-11	54.0	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000018380

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016769	0.983	CD244 molecule, natural killer cell receptor 2B4
2	61853.ENSNLEP00000015723	0.978	FYN proto-oncogene, Src family tyrosine kinase
3	61853.ENSNLEP00000016599	0.978	Signaling lymphocytic activation molecule family member 1
4	61853.ENSNLEP00000016569	0.910	CD84 molecule
5	61853.ENSNLEP00000016536	0.872	SLAM family member 6
6	61853.ENSNLEP00000016703	0.848	Lymphocyte antigen 9
7	61853.ENSNLEP00000016637	0.724	SLAM family member 7
8	61853.ENSNLEP00000012296	0.638	Uncharacterized protein
9	61853.ENSNLEP00000015863	0.631	Fyn-related Src family tyrosine kinase
10	61853.ENSNLEP00000015509	0.613	Adaptor-related protein complex 3, beta 1 subunit
11	61853.ENSNLEP00000002297	0.608	ADP-ribosylation factor-like 13B
12	61853.ENSNLEP00000007631	0.601	Tyrosine-protein kinase
13	61853.ENSNLEP00000008358	0.601	Tyrosine-protein kinase
14	61853.ENSNLEP00000001339	0.567	Syntaxin binding protein 2
15	61853.ENSNLEP00000003892	0.559	SH2 domain containing 4A
16	61853.ENSNLEP00000001909	0.558	Unc-13 homolog D (C. elegans)
17	61853.ENSNLEP00000007036	0.558	LPS-responsive vesicle trafficking, beach and anchor containing
18	61853.ENSNLEP00000004798	0.550	IL2-inducible T-cell kinase
19	61853.ENSNLEP00000018428	0.550	DnaJ (Hsp40) homolog, subfamily C, member 6
20	61853.ENSNLEP00000009707	0.548	SH2 domain containing 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.524	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050776	0.988	regulation of immune response
GO:0009987	0.983	cellular process
GO:0050896	0.979	response to stimulus
GO:0048519	0.972	negative regulation of biological process
GO:0048523	0.941	negative regulation of cellular process
GO:0048518	0.917	positive regulation of biological process
GO:0048522	0.784	positive regulation of cellular process
GO:0048585	0.761	negative regulation of response to stimulus
GO:0023051	0.758	regulation of signaling
GO:0010646	0.758	regulation of cell communication
GO:0009966	0.749	regulation of signal transduction
GO:0050854	0.535	regulation of antigen receptor-mediated signaling pathway
GO:0023057	0.475	negative regulation of signaling
GO:0002684	0.475	positive regulation of immune system process
GO:0010648	0.475	negative regulation of cell communication
GO:0002376	0.449	immune system process
GO:0048584	0.411	positive regulation of response to stimulus
GO:0051716	0.390	cellular response to stimulus
GO:0009968	0.372	negative regulation of signal transduction
GO:0019222	0.342	regulation of metabolic process
GO:0007154	0.329	cell communication
GO:0023052	0.327	signaling
GO:0007165	0.324	signal transduction
GO:0006955	0.309	immune response
GO:0060255	0.303	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.905	organelle
GO:0043229	0.865	intracellular organelle
GO:0043227	0.743	membrane-bounded organelle
GO:0043231	0.689	intracellular membrane-bounded organelle
GO:0016020	0.358	membrane
GO:0005634	0.352	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]