StarFunc result for job id O60883

User Input

>input (481 residues)
MRWLWPLAVSLAVILAVGLSRVSGGAPLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYV
PEEWAEYPRPIHPAGLQPTKPLVATSPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPL
YPVTESSYSAYAIMLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVL
FFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVR
PIERCQSILAKLAVIWVGSMTLAVPELLLWQLAQEPAPTMGTLDSCIMKPSASLPESLYS
LVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKSECRASKHEQCESQLNST
VVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCIC
RPLGQAFLDCCCCCCCEECGGASEASAANGSDNKLKTEVSSSIYFHKPRESPPLLPLGTP
C

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60883	1.000	1.000	1.042E-61	481	1.000	1.000	O60883.pdb.gz	G37L1_HUMAN G-protein coupled receptor 37-like 1 OS=Homo sapiens OX=9606 GN=GPR37L1 PE=1 SV=2
2	AFDB:P25101	0.589	0.660	1.919E-16	427	0.193	0.218	P25101.pdb.gz	EDNRA_HUMAN Endothelin-1 receptor OS=Homo sapiens OX=9606 GN=EDNRA PE=1 SV=1
3	AFDB:P21451	0.608	0.657	3.243E-16	442	0.212	0.231	P21451.pdb.gz	EDNRB_RAT Endothelin receptor type B OS=Rattus norvegicus OX=10116 GN=Ednrb PE=2 SV=2
4	AFDB:P24530	0.586	0.635	4.808E-16	442	0.195	0.213	P24530.pdb.gz	EDNRB_HUMAN Endothelin receptor type B OS=Homo sapiens OX=9606 GN=EDNRB PE=1 SV=1
5	AFDB:F8W4W1	0.578	0.674	9.265E-16	408	0.189	0.223	F8W4W1.pdb.gz
6	AFDB:A5JV23	0.585	0.659	6.632E-15	422	0.189	0.216	A5JV23.pdb.gz
7	AFDB:P21729	0.588	0.727	5.412E-14	384	0.168	0.211	P21729.pdb.gz	GRPR_MOUSE Gastrin-releasing peptide receptor OS=Mus musculus OX=10090 GN=Grpr PE=1 SV=2
8	AFDB:Q4V622	0.538	0.530	1.480E-13	489	0.170	0.168	Q4V622.pdb.gz	CCH2R_DROME Neuropeptide CCHamide-2 receptor OS=Drosophila melanogaster OX=7227 GN=CCHa2-R PE=2 SV=1
9	AFDB:O54799	0.550	0.669	2.010E-13	390	0.156	0.192	O54799.pdb.gz	NMBR_MOUSE Neuromedin-B receptor OS=Mus musculus OX=10090 GN=Nmbr PE=1 SV=1
10	AFDB:P83861	0.570	0.629	4.417E-13	433	0.135	0.150	P83861.pdb.gz	QRFPR_MOUSE Pyroglutamylated RF-amide peptide receptor OS=Mus musculus OX=10090 GN=Qrfpr PE=2 SV=1
11	PDB:7sqoR	0.469	0.789	1.805E-10	270	0.110	0.196	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
12	PDB:7w55R	0.500	0.759	2.150E-10	303	0.106	0.168	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
13	PDB:5glhA	0.483	0.513	4.935E-10	452	0.162	0.173	5glhA.pdb.gz	Activation mechanism of endothelin ETB receptor by endothelin-1.
14	PDB:7mbyR	0.488	0.792	8.715E-10	283	0.106	0.180	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
15	PDB:7x9cR	0.522	0.796	8.715E-10	302	0.123	0.195	7x9cR.pdb.gz
16	PDB:7w56R	0.462	0.766	9.937E-10	276	0.131	0.228	7w56R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
17	PDB:7x9bR	0.513	0.784	9.937E-10	302	0.121	0.192	7x9bR.pdb.gz
18	PDB:7wq4R	0.504	0.823	1.350E-9	282	0.119	0.202	7wq4R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
19	PDB:7wq3R	0.506	0.803	1.539E-9	289	0.116	0.194	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
20	PDB:5zbqA	0.488	0.506	3.381E-9	463	0.121	0.125	5zbqA.pdb.gz	Structural basis of ligand binding modes at the neuropeptide Y Y1receptor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60883	0.0	983	481	1.000	1.000	G37L1_HUMAN G-protein coupled receptor 37-like 1 OS=Homo sapiens OX=9606 GN=GPR37L1 PE=1 SV=2
2	Q99JG2	0.0	867	481	0.909	0.909	G37L1_MOUSE G-protein coupled receptor 37-like 1 OS=Mus musculus OX=10090 GN=Gpr37l1 PE=1 SV=2
3	Q9QY42	1.22e-130	393	600	0.432	0.347	GPR37_MOUSE Prosaposin receptor GPR37 OS=Mus musculus OX=10090 GN=Gpr37 PE=2 SV=1
4	O15354	2.16e-128	387	613	0.424	0.333	GPR37_HUMAN Prosaposin receptor GPR37 OS=Homo sapiens OX=9606 GN=GPR37 PE=1 SV=2
5	B3DLG5	8.21e-31	125	422	0.187	0.213	B3DLG5_DANRE Endothelin-1 receptor OS=Danio rerio OX=7955 GN=ednra PE=2 SV=1
6	Q9DGM2	5.00e-30	123	426	0.191	0.216	Q9DGM2_DANRE Endothelin receptor type B OS=Danio rerio OX=7955 GN=ednrb1 PE=2 SV=1
7	P24530	7.81e-30	123	442	0.183	0.199	EDNRB_HUMAN Endothelin receptor type B OS=Homo sapiens OX=9606 GN=EDNRB PE=1 SV=1
8	P21451	8.95e-30	123	442	0.183	0.199	EDNRB_RAT Endothelin receptor type B OS=Rattus norvegicus OX=10116 GN=Ednrb PE=2 SV=2
9	P48302	1.72e-29	122	442	0.181	0.197	EDNRB_MOUSE Endothelin receptor type B OS=Mus musculus OX=10090 GN=Ednrb PE=2 SV=1
10	Q61614	1.65e-26	113	427	0.156	0.176	EDNRA_MOUSE Endothelin-1 receptor OS=Mus musculus OX=10090 GN=Ednra PE=2 SV=3
11	P25101	1.49e-25	110	427	0.156	0.176	EDNRA_HUMAN Endothelin-1 receptor OS=Homo sapiens OX=9606 GN=EDNRA PE=1 SV=1
12	P26684	1.61e-25	110	426	0.154	0.174	EDNRA_RAT Endothelin-1 receptor OS=Rattus norvegicus OX=10116 GN=Ednra PE=2 SV=2
13	Q8K418	9.76e-17	84.3	399	0.160	0.193	BRS3_RAT Bombesin receptor subtype-3 OS=Rattus norvegicus OX=10116 GN=Brs3 PE=2 SV=1
14	P32247	2.79e-16	82.8	399	0.162	0.195	BRS3_HUMAN Bombesin receptor subtype-3 OS=Homo sapiens OX=9606 GN=BRS3 PE=1 SV=1
15	P25929	1.63e-15	80.5	384	0.158	0.198	NPY1R_HUMAN Neuropeptide Y receptor type 1 OS=Homo sapiens OX=9606 GN=NPY1R PE=1 SV=1
16	P24053	4.45e-15	79.0	390	0.148	0.182	NMBR_RAT Neuromedin-B receptor OS=Rattus norvegicus OX=10116 GN=Nmbr PE=2 SV=1
17	Q4V622	7.06e-15	79.0	489	0.191	0.188	CCH2R_DROME Neuropeptide CCHamide-2 receptor OS=Drosophila melanogaster OX=7227 GN=CCHa2-R PE=2 SV=1
18	Q9TUP7	1.87e-14	77.4	444	0.158	0.171	OX2R_CANLF Orexin receptor type 2 OS=Canis lupus familiaris OX=9615 GN=HCRTR2 PE=1 SV=1
19	O54799	3.13e-14	76.6	390	0.148	0.182	NMBR_MOUSE Neuromedin-B receptor OS=Mus musculus OX=10090 GN=Nmbr PE=1 SV=1
20	P28336	3.21e-14	76.6	390	0.148	0.182	NMBR_HUMAN Neuromedin-B receptor OS=Homo sapiens OX=9606 GN=NMBR PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.6e-17	75.3	7 transmembrane receptor (rhodopsin family)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356251

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378394	0.910	Prosaposin
2	9606.ENSP00000350266	0.709	DENN domain-containing protein 2D
3	9606.ENSP00000358529	0.695	Tetraspanin-2
4	9606.ENSP00000468500	0.627	Glial fibrillary acidic protein
5	9606.ENSP00000286692	0.622	DNA damage-regulated autophagy modulator protein 2
6	9606.ENSP00000357707	0.618	Protein S100-A5
7	9606.ENSP00000332353	0.576	Protein patched homolog 1
8	9606.ENSP00000308413	0.564	Ribosomal protein S6 kinase beta-2
9	9606.ENSP00000378089	0.526	Neuromedin-B
10	9606.ENSP00000256857	0.515	Gastrin-releasing peptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004930	1.000	G protein-coupled receptor activity
GO:0001653	0.946	peptide receptor activity
GO:0008528	0.941	G protein-coupled peptide receptor activity
GO:0042277	0.421	peptide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0007154	0.987	cell communication
GO:0023052	0.986	signaling
GO:0051716	0.943	cellular response to stimulus
GO:0007165	0.908	signal transduction
GO:0048522	0.896	positive regulation of cellular process
GO:0007186	0.808	G protein-coupled receptor signaling pathway
GO:1902531	0.795	regulation of intracellular signal transduction
GO:0009967	0.763	positive regulation of signal transduction
GO:0043408	0.634	regulation of MAPK cascade
GO:1902533	0.582	positive regulation of intracellular signal transduction
GO:0032501	0.488	multicellular organismal process
GO:0043410	0.350	positive regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.533	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]