StarFunc result for job id O60894

User Input

>input (148 residues)
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60894	1.000	1.000	6.424E-24	148	1.000	1.000	O60894.pdb.gz	RAMP1_HUMAN Receptor activity-modifying protein 1 OS=Homo sapiens OX=9606 GN=RAMP1 PE=1 SV=1
2	AFDB:Q9JJ74	0.832	0.832	9.159E-18	148	0.716	0.716	Q9JJ74.pdb.gz	RAMP1_RAT Receptor activity-modifying protein 1 OS=Rattus norvegicus OX=10116 GN=Ramp1 PE=2 SV=1
3	AFDB:Q867C0	0.832	0.832	7.242E-17	148	0.682	0.682	Q867C0.pdb.gz	RAMP1_PIG Receptor activity-modifying protein 1 OS=Sus scrofa OX=9823 GN=RAMP1 PE=2 SV=1
4	PDB:7knuE	0.737	0.940	6.127E-16	115	0.764	0.983	7knuE.pdb.gz	Structure and dynamics of the CGRP receptor in apo and peptide-bound forms.
5	AFDB:Q7YS88	0.539	0.530	2.315E-8	151	0.358	0.351	Q7YS88.pdb.gz	RAMP3_PIG Receptor activity-modifying protein 3 OS=Sus scrofa OX=9823 GN=RAMP3 PE=2 SV=1
6	AFDB:Q9JJ73	0.529	0.533	1.351E-7	147	0.297	0.299	Q9JJ73.pdb.gz	RAMP3_RAT Receptor activity-modifying protein 3 OS=Rattus norvegicus OX=10116 GN=Ramp3 PE=2 SV=1
7	AFDB:J3KR56	0.546	0.536	1.525E-7	151	0.318	0.311	J3KR56.pdb.gz	J3KR56_HUMAN Receptor activity modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=1 SV=1
8	AFDB:O60895	0.578	0.506	1.068E-6	175	0.291	0.246	O60895.pdb.gz	RAMP2_HUMAN Receptor activity-modifying protein 2 OS=Homo sapiens OX=9606 GN=RAMP2 PE=1 SV=2
9	AFDB:Q867B9	0.550	0.477	3.604E-6	177	0.277	0.232	Q867B9.pdb.gz	Q867B9_PIG Receptor activity-modifying protein 2 OS=Sus scrofa OX=9823 PE=2 SV=1
10	AFDB:Q9JHJ1	0.456	0.385	4.325E-6	182	0.270	0.220	Q9JHJ1.pdb.gz	RAMP2_RAT Receptor activity-modifying protein 2 OS=Rattus norvegicus OX=10116 GN=Ramp2 PE=2 SV=1
11	PDB:7tzfE	0.605	0.757	4.628E-6	114	0.250	0.325	7tzfE.pdb.gz	A structural basis for amylin receptor phenotype.
12	AFDB:Q9WUP0	0.519	0.430	1.216E-5	189	0.223	0.175	Q9WUP0.pdb.gz	RAMP2_MOUSE Receptor activity-modifying protein 2 OS=Mus musculus OX=10090 GN=Ramp2 PE=1 SV=1
13	PDB:7tyxE	0.589	0.747	4.133E-5	112	0.230	0.304	7tyxE.pdb.gz	A structural basis for amylin receptor phenotype.
14	PDB:5x3xQ	0.185	0.133	2.650	243	0.115	0.070	5x3xQ.pdb.gz
15	PDB:5n9jZ	0.174	0.199	3.591	119	0.101	0.126	5n9jZ.pdb.gz
16	PDB:8a2qB	0.163	0.041	4.056	1084	0.108	0.015	8a2qB.pdb.gz
17	PDB:3qouA	0.209	0.130	4.310	282	0.108	0.057	3qouA.pdb.gz	Escherichia coli Thioredoxin-like Protein YbbN Contains an Atypical Tetratricopeptide Repeat Motif and Is a Negative Regulator of GroEL.
18	PDB:6lojB	0.279	0.101	5.497	571	0.088	0.023	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
19	PDB:7dvqK	0.142	0.119	5.497	188	0.041	0.032	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:6ff7p	0.218	0.186	6.598	175	0.074	0.063	6ff7p.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60894	2.86e-108	306	148	1.000	1.000	RAMP1_HUMAN Receptor activity-modifying protein 1 OS=Homo sapiens OX=9606 GN=RAMP1 PE=1 SV=1
2	Q9JJ74	2.82e-77	228	148	0.716	0.716	RAMP1_RAT Receptor activity-modifying protein 1 OS=Rattus norvegicus OX=10116 GN=Ramp1 PE=2 SV=1
3	Q9WTJ5	4.94e-76	224	148	0.709	0.709	RAMP1_MOUSE Receptor activity-modifying protein 1 OS=Mus musculus OX=10090 GN=Ramp1 PE=1 SV=1
4	Q867C0	1.03e-74	221	148	0.682	0.682	RAMP1_PIG Receptor activity-modifying protein 1 OS=Sus scrofa OX=9823 GN=RAMP1 PE=2 SV=1
5	Q7YS88	1.26e-22	89.4	151	0.318	0.311	RAMP3_PIG Receptor activity-modifying protein 3 OS=Sus scrofa OX=9823 GN=RAMP3 PE=2 SV=1
6	A4D2L1	1.92e-20	83.6	148	0.291	0.291	A4D2L1_HUMAN Receptor (Calcitonin) activity modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=2 SV=1
7	O60896	1.92e-20	83.6	148	0.291	0.291	RAMP3_HUMAN Receptor activity-modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=1 SV=1
8	J3KR56	1.96e-20	83.6	151	0.291	0.285	J3KR56_HUMAN Receptor activity modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=1 SV=1
9	Q9JJ73	4.98e-19	79.7	147	0.264	0.265	RAMP3_RAT Receptor activity-modifying protein 3 OS=Rattus norvegicus OX=10116 GN=Ramp3 PE=2 SV=1
10	Q9WUP1	9.29e-19	79.3	147	0.257	0.259	RAMP3_MOUSE Receptor activity-modifying protein 3 OS=Mus musculus OX=10090 GN=Ramp3 PE=2 SV=1
11	O60895	3.01e-16	73.6	175	0.236	0.200	RAMP2_HUMAN Receptor activity-modifying protein 2 OS=Homo sapiens OX=9606 GN=RAMP2 PE=1 SV=2
12	Q9WUP0	5.42e-14	67.8	189	0.216	0.169	RAMP2_MOUSE Receptor activity-modifying protein 2 OS=Mus musculus OX=10090 GN=Ramp2 PE=1 SV=1
13	Q867B9	2.30e-13	65.9	177	0.243	0.203	Q867B9_PIG Receptor activity-modifying protein 2 OS=Sus scrofa OX=9823 PE=2 SV=1
14	Q9JHJ1	1.78e-12	63.5	182	0.216	0.176	RAMP2_RAT Receptor activity-modifying protein 2 OS=Rattus norvegicus OX=10116 GN=Ramp2 PE=2 SV=1
15	B7FNJ0	0.19	33.9	1680	0.196	0.017	B7FNJ0_DROME FI03643p (Fragment) OS=Drosophila melanogaster OX=7227 GN=polybromo-RA PE=2 SV=1
16	Q7YU13	0.19	33.9	1654	0.196	0.018	Q7YU13_DROME LD26355p OS=Drosophila melanogaster OX=7227 GN=polybromo PE=2 SV=1
17	Q9VC36	0.19	33.9	1654	0.196	0.018	Q9VC36_DROME Polybromo OS=Drosophila melanogaster OX=7227 GN=polybromo PE=1 SV=1
18	O18335	1.3	30.8	214	0.108	0.075	O18335_DROME Drab11 OS=Drosophila melanogaster OX=7227 GN=Rab11 PE=1 SV=1
19	Q8IGH2	1.3	30.8	214	0.108	0.075	Q8IGH2_DROME RH21315p OS=Drosophila melanogaster OX=7227 GN=Rab11 PE=2 SV=1
20	O15031	6.2	29.3	1838	0.068	0.005	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04901 RAMP	1.2e-41	152.6	Receptor activity modifying family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254661

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331746	0.999	Calcitonin
2	9606.ENSP00000386972	0.999	Calcitonin gene-related peptide type 1 receptor
3	9606.ENSP00000352561	0.998	Calcitonin receptor
4	9606.ENSP00000436607	0.990	ADM
5	9606.ENSP00000240652	0.975	Islet amyloid polypeptide
6	9606.ENSP00000360141	0.964	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
7	9606.ENSP00000433490	0.950	Calcitonin gene-related peptide 2
8	9606.ENSP00000253796	0.923	Receptor activity-modifying protein 2
9	9606.ENSP00000242249	0.919	Receptor activity-modifying protein 3
10	9606.ENSP00000354896	0.907	Metabotropic glutamate receptor 1
11	9606.ENSP00000379087	0.899	ADM2
12	9606.ENSP00000327246	0.836	Vasoactive intestinal polypeptide receptor 1
13	9606.ENSP00000394484	0.835	Serine/threonine-protein kinase DCLK3
14	9606.ENSP00000334448	0.802	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
15	9606.ENSP00000481878	0.800	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
16	9606.ENSP00000378736	0.798	DNA-directed RNA polymerase III subunit RPC9
17	9606.ENSP00000259392	0.773	Probable low affinity copper uptake protein 2
18	9606.ENSP00000259455	0.740	Gamma-aminobutyric acid type B receptor subunit 2
19	9606.ENSP00000366233	0.730	Gamma-aminobutyric acid type B receptor subunit 1
20	9606.ENSP00000393631	0.716	Putative adrenomedullin-5-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	0.998	protein binding
GO:0042562	0.994	hormone binding
GO:0004930	0.988	G protein-coupled receptor activity
GO:0042277	0.969	peptide binding
GO:0008528	0.965	G protein-coupled peptide receptor activity
GO:0017046	0.932	peptide hormone binding
GO:0097642	0.687	calcitonin family receptor activity
GO:0097643	0.673	amylin receptor activity
GO:0015026	0.642	coreceptor activity
GO:0097644	0.449	calcitonin family binding
GO:0001635	0.370	calcitonin gene-related peptide receptor activity
GO:1990407	0.367	calcitonin gene-related peptide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0007186	0.986	G protein-coupled receptor signaling pathway
GO:0007188	0.959	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	0.937	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0006810	0.629	transport
GO:0032501	0.494	multicellular organismal process
GO:0019222	0.423	regulation of metabolic process
GO:0032502	0.410	developmental process
GO:0048518	0.352	positive regulation of biological process
GO:0007275	0.352	multicellular organism development
GO:0060255	0.344	regulation of macromolecule metabolic process
GO:0048522	0.326	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043235	0.986	receptor complex
GO:0098797	0.979	plasma membrane protein complex
GO:0098802	0.927	plasma membrane signaling receptor complex
GO:0097648	0.795	G protein-coupled receptor complex
GO:0009986	0.683	cell surface
GO:1903440	0.385	amylin receptor complex
GO:1990406	0.328	CGRP receptor complex
GO:0150056	0.328	amylin receptor complex 1
GO:0005576	0.321	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]