StarFunc result for job id O60895

User Input

>input (175 residues)
MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKN
YETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERII
FETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60895	1.000	1.000	7.647E-26	175	1.000	1.000	O60895.pdb.gz	RAMP2_HUMAN Receptor activity-modifying protein 2 OS=Homo sapiens OX=9606 GN=RAMP2 PE=1 SV=2
2	AFDB:Q867B9	0.643	0.636	1.614E-18	177	0.731	0.723	Q867B9.pdb.gz	Q867B9_PIG Receptor activity-modifying protein 2 OS=Sus scrofa OX=9823 PE=2 SV=1
3	AFDB:Q9WUP0	0.665	0.617	6.039E-17	189	0.680	0.630	Q9WUP0.pdb.gz	RAMP2_MOUSE Receptor activity-modifying protein 2 OS=Mus musculus OX=10090 GN=Ramp2 PE=1 SV=1
4	AFDB:Q9JHJ1	0.670	0.645	9.843E-16	182	0.663	0.637	Q9JHJ1.pdb.gz	RAMP2_RAT Receptor activity-modifying protein 2 OS=Rattus norvegicus OX=10116 GN=Ramp2 PE=2 SV=1
5	PDB:7tyxE	0.538	0.802	6.603E-14	112	0.617	0.964	7tyxE.pdb.gz	A structural basis for amylin receptor phenotype.
6	PDB:7tyhE	0.385	0.668	7.843E-10	97	0.543	0.979	7tyhE.pdb.gz
7	AFDB:J3KR56	0.576	0.657	4.236E-8	151	0.257	0.298	J3KR56.pdb.gz	J3KR56_HUMAN Receptor activity modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=1 SV=1
8	AFDB:Q7YS88	0.583	0.663	6.049E-8	151	0.257	0.298	Q7YS88.pdb.gz	RAMP3_PIG Receptor activity-modifying protein 3 OS=Sus scrofa OX=9823 GN=RAMP3 PE=2 SV=1
9	AFDB:O60894	0.506	0.578	1.761E-7	148	0.246	0.291	O60894.pdb.gz	RAMP1_HUMAN Receptor activity-modifying protein 1 OS=Homo sapiens OX=9606 GN=RAMP1 PE=1 SV=1
10	AFDB:Q9JJ73	0.593	0.691	3.385E-7	147	0.257	0.306	Q9JJ73.pdb.gz	RAMP3_RAT Receptor activity-modifying protein 3 OS=Rattus norvegicus OX=10116 GN=Ramp3 PE=2 SV=1
11	AFDB:Q867C0	0.486	0.557	7.325E-7	148	0.234	0.277	Q867C0.pdb.gz	RAMP1_PIG Receptor activity-modifying protein 1 OS=Sus scrofa OX=9823 GN=RAMP1 PE=2 SV=1
12	AFDB:Q9JJ74	0.481	0.550	7.773E-7	148	0.240	0.284	Q9JJ74.pdb.gz	RAMP1_RAT Receptor activity-modifying protein 1 OS=Rattus norvegicus OX=10116 GN=Ramp1 PE=2 SV=1
13	PDB:7knuE	0.469	0.652	3.603E-6	115	0.206	0.313	7knuE.pdb.gz	Structure and dynamics of the CGRP receptor in apo and peptide-bound forms.
14	PDB:7tzfE	0.536	0.776	8.386E-5	114	0.194	0.298	7tzfE.pdb.gz	A structural basis for amylin receptor phenotype.
15	PDB:5xjt2	0.135	0.118	5.837E-1	217	0.154	0.124	5xjt2.pdb.gz	Structures of 7S mutant complexes
16	PDB:6wb94	0.144	0.168	8.846E-1	148	0.103	0.122	6wb94.pdb.gz
17	PDB:3bviF	0.209	0.210	1.423	173	0.103	0.104	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
18	PDB:5n9jZ	0.191	0.255	2.031	119	0.080	0.118	5n9jZ.pdb.gz
19	PDB:2jmhA	0.189	0.249	2.156	117	0.034	0.051	2jmhA.pdb.gz
20	PDB:5l4kP	0.170	0.074	2.288	456	0.057	0.022	5l4kP.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60895	6.85e-130	363	175	1.000	1.000	RAMP2_HUMAN Receptor activity-modifying protein 2 OS=Homo sapiens OX=9606 GN=RAMP2 PE=1 SV=2
2	Q867B9	6.47e-82	241	177	0.760	0.751	Q867B9_PIG Receptor activity-modifying protein 2 OS=Sus scrofa OX=9823 PE=2 SV=1
3	Q9WUP0	2.34e-67	205	189	0.669	0.619	RAMP2_MOUSE Receptor activity-modifying protein 2 OS=Mus musculus OX=10090 GN=Ramp2 PE=1 SV=1
4	Q9JHJ1	2.86e-64	197	182	0.657	0.632	RAMP2_RAT Receptor activity-modifying protein 2 OS=Rattus norvegicus OX=10116 GN=Ramp2 PE=2 SV=1
5	Q9WTJ5	1.25e-18	79.7	148	0.223	0.264	RAMP1_MOUSE Receptor activity-modifying protein 1 OS=Mus musculus OX=10090 GN=Ramp1 PE=1 SV=1
6	Q9JJ74	5.98e-17	75.5	148	0.211	0.250	RAMP1_RAT Receptor activity-modifying protein 1 OS=Rattus norvegicus OX=10116 GN=Ramp1 PE=2 SV=1
7	O60894	2.28e-16	73.9	148	0.200	0.236	RAMP1_HUMAN Receptor activity-modifying protein 1 OS=Homo sapiens OX=9606 GN=RAMP1 PE=1 SV=1
8	Q867C0	2.51e-16	73.9	148	0.211	0.250	RAMP1_PIG Receptor activity-modifying protein 1 OS=Sus scrofa OX=9823 GN=RAMP1 PE=2 SV=1
9	Q7YS88	1.11e-15	72.0	151	0.217	0.252	RAMP3_PIG Receptor activity-modifying protein 3 OS=Sus scrofa OX=9823 GN=RAMP3 PE=2 SV=1
10	A4D2L1	1.55e-15	71.6	148	0.211	0.250	A4D2L1_HUMAN Receptor (Calcitonin) activity modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=2 SV=1
11	O60896	1.55e-15	71.6	148	0.211	0.250	RAMP3_HUMAN Receptor activity-modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=1 SV=1
12	J3KR56	1.97e-15	71.6	151	0.211	0.245	J3KR56_HUMAN Receptor activity modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=1 SV=1
13	Q9WUP1	4.97e-14	67.8	147	0.189	0.224	RAMP3_MOUSE Receptor activity-modifying protein 3 OS=Mus musculus OX=10090 GN=Ramp3 PE=2 SV=1
14	Q9JJ73	1.65e-13	66.2	147	0.183	0.218	RAMP3_RAT Receptor activity-modifying protein 3 OS=Rattus norvegicus OX=10116 GN=Ramp3 PE=2 SV=1
15	Q8IQ30	0.18	34.7	1155	0.189	0.029	Q8IQ30_DROME Trabuco, isoform C OS=Drosophila melanogaster OX=7227 GN=tbc PE=3 SV=3
16	Q9M207	6.1	28.9	129	0.069	0.093	Q9M207_ARATH At3g60520 OS=Arabidopsis thaliana OX=3702 GN=T8B10_180 PE=1 SV=1
17	Q38A96	8.2	29.6	2169	0.063	0.005	Q38A96_TRYB2 Cilia- and flagella-associated protein 206 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1760 PE=4 SV=1
18	Q8IL26	8.3	29.3	1558	0.091	0.010	EIK1_PLAF7 Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=eIK1 PE=1 SV=1
19	P48382	9.2	29.3	616	0.137	0.039	RFX5_HUMAN DNA-binding protein RFX5 OS=Homo sapiens OX=9606 GN=RFX5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04901 RAMP	9.5e-39	143.2	Receptor activity modifying family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253796

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386972	0.999	Calcitonin gene-related peptide type 1 receptor
2	9606.ENSP00000436607	0.999	ADM
3	9606.ENSP00000331746	0.992	Calcitonin
4	9606.ENSP00000352561	0.982	Calcitonin receptor
5	9606.ENSP00000327246	0.967	Vasoactive intestinal polypeptide receptor 1
6	9606.ENSP00000360141	0.962	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
7	9606.ENSP00000383558	0.961	Glucagon receptor
8	9606.ENSP00000433490	0.950	Calcitonin gene-related peptide 2
9	9606.ENSP00000240652	0.947	Islet amyloid polypeptide
10	9606.ENSP00000379087	0.940	ADM2
11	9606.ENSP00000242249	0.932	Receptor activity-modifying protein 3
12	9606.ENSP00000254661	0.923	Receptor activity-modifying protein 1
13	9606.ENSP00000354896	0.903	Metabotropic glutamate receptor 1
14	9606.ENSP00000394484	0.807	Serine/threonine-protein kinase DCLK3
15	9606.ENSP00000334448	0.803	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
16	9606.ENSP00000481878	0.800	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
17	9606.ENSP00000321999	0.773	Parathyroid hormone/parathyroid hormone-related peptide receptor
18	9606.ENSP00000259455	0.768	Gamma-aminobutyric acid type B receptor subunit 2
19	9606.ENSP00000366233	0.767	Gamma-aminobutyric acid type B receptor subunit 1
20	9606.ENSP00000381333	0.764	Corticotropin-releasing factor receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004930	0.997	G protein-coupled receptor activity
GO:0042277	0.995	peptide binding
GO:0001653	0.993	peptide receptor activity
GO:0008528	0.982	G protein-coupled peptide receptor activity
GO:0042562	0.975	hormone binding
GO:0017046	0.969	peptide hormone binding
GO:0097642	0.860	calcitonin family receptor activity
GO:0097643	0.853	amylin receptor activity
GO:0097644	0.728	calcitonin family binding
GO:0015026	0.706	coreceptor activity
GO:0001605	0.680	adrenomedullin receptor activity
GO:1990409	0.412	adrenomedullin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0007186	0.991	G protein-coupled receptor signaling pathway
GO:0007188	0.970	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	0.964	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0006810	0.944	transport
GO:0032502	0.938	developmental process
GO:0032501	0.938	multicellular organismal process
GO:0048856	0.924	anatomical structure development
GO:0065008	0.877	regulation of biological quality
GO:0006898	0.857	receptor-mediated endocytosis
GO:0007275	0.813	multicellular organism development
GO:0010941	0.802	regulation of cell death
GO:0031623	0.797	receptor internalization
GO:0048523	0.789	negative regulation of cellular process
GO:0048518	0.752	positive regulation of biological process
GO:0009893	0.739	positive regulation of metabolic process
GO:0060255	0.738	regulation of macromolecule metabolic process
GO:0048731	0.729	system development
GO:0003008	0.704	system process
GO:0071840	0.683	cellular component organization or biogenesis
GO:0016043	0.673	cellular component organization
GO:0022607	0.635	cellular component assembly
GO:0010604	0.595	positive regulation of macromolecule metabolic process
GO:0045216	0.594	cell-cell junction organization
GO:0042981	0.555	regulation of apoptotic process
GO:0010468	0.497	regulation of gene expression
GO:0007043	0.486	cell-cell junction assembly
GO:0034332	0.483	adherens junction organization
GO:0048522	0.429	positive regulation of cellular process
GO:0001944	0.409	vasculature development
GO:0008015	0.376	blood circulation
GO:1904035	0.355	regulation of epithelial cell apoptotic process
GO:0009653	0.336	anatomical structure morphogenesis
GO:0003018	0.332	vascular process in circulatory system
GO:2000351	0.327	regulation of endothelial cell apoptotic process
GO:0120193	0.316	tight junction organization
GO:1904036	0.310	negative regulation of epithelial cell apoptotic process
GO:0048514	0.300	blood vessel morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0098802	0.997	plasma membrane signaling receptor complex
GO:0097648	0.992	G protein-coupled receptor complex
GO:0012505	0.989	endomembrane system
GO:0009986	0.979	cell surface
GO:0000323	0.951	lytic vacuole
GO:0005764	0.942	lysosome
GO:0098590	0.698	plasma membrane region
GO:1903440	0.686	amylin receptor complex
GO:1903143	0.670	adrenomedullin receptor complex
GO:0150057	0.654	amylin receptor complex 2
GO:0005905	0.622	clathrin-coated pit
GO:0031982	0.318	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]