StarFunc result for job id O60896

User Input

>input (148 residues)
METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLS
EFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLI
PLIVIPVVLTVAMAGLVVWRSKRTDTLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KR56	0.850	0.835	8.755E-22	151	0.993	0.974	J3KR56.pdb.gz	J3KR56_HUMAN Receptor activity modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=1 SV=1
2	AFDB:Q9JJ73	0.846	0.852	1.786E-18	147	0.818	0.823	Q9JJ73.pdb.gz	RAMP3_RAT Receptor activity-modifying protein 3 OS=Rattus norvegicus OX=10116 GN=Ramp3 PE=2 SV=1
3	AFDB:Q7YS88	0.831	0.815	1.200E-17	151	0.723	0.709	Q7YS88.pdb.gz	RAMP3_PIG Receptor activity-modifying protein 3 OS=Sus scrofa OX=9823 GN=RAMP3 PE=2 SV=1
4	PDB:7tzfE	0.628	0.786	4.536E-13	114	0.757	0.982	7tzfE.pdb.gz	A structural basis for amylin receptor phenotype.
5	AFDB:Q9JJ74	0.556	0.556	3.735E-9	148	0.358	0.358	Q9JJ74.pdb.gz	RAMP1_RAT Receptor activity-modifying protein 1 OS=Rattus norvegicus OX=10116 GN=Ramp1 PE=2 SV=1
6	AFDB:O60895	0.686	0.591	1.897E-8	175	0.304	0.257	O60895.pdb.gz	RAMP2_HUMAN Receptor activity-modifying protein 2 OS=Homo sapiens OX=9606 GN=RAMP2 PE=1 SV=2
7	AFDB:Q9JHJ1	0.668	0.553	2.244E-8	182	0.358	0.291	Q9JHJ1.pdb.gz	RAMP2_RAT Receptor activity-modifying protein 2 OS=Rattus norvegicus OX=10116 GN=Ramp2 PE=2 SV=1
8	AFDB:O60894	0.546	0.546	3.141E-8	148	0.318	0.318	O60894.pdb.gz	RAMP1_HUMAN Receptor activity-modifying protein 1 OS=Homo sapiens OX=9606 GN=RAMP1 PE=1 SV=1
9	AFDB:Q867B9	0.617	0.530	4.917E-8	177	0.311	0.260	Q867B9.pdb.gz	Q867B9_PIG Receptor activity-modifying protein 2 OS=Sus scrofa OX=9823 PE=2 SV=1
10	AFDB:Q9WUP0	0.671	0.543	9.632E-8	189	0.324	0.254	Q9WUP0.pdb.gz	RAMP2_MOUSE Receptor activity-modifying protein 2 OS=Mus musculus OX=10090 GN=Ramp2 PE=1 SV=1
11	AFDB:Q867C0	0.551	0.551	1.205E-7	148	0.351	0.351	Q867C0.pdb.gz	RAMP1_PIG Receptor activity-modifying protein 1 OS=Sus scrofa OX=9823 GN=RAMP1 PE=2 SV=1
12	PDB:7knuE	0.503	0.633	2.233E-6	115	0.243	0.313	7knuE.pdb.gz	Structure and dynamics of the CGRP receptor in apo and peptide-bound forms.
13	PDB:7tyxE	0.573	0.724	2.628E-5	112	0.223	0.295	7tyxE.pdb.gz	A structural basis for amylin receptor phenotype.
14	PDB:7tyhE	0.426	0.628	1.321E-2	97	0.189	0.289	7tyhE.pdb.gz
15	PDB:7qvmR	0.268	0.170	8.350E-1	250	0.101	0.060	7qvmR.pdb.gz	Structural basis for the activation and ligand recognition of the human oxytocin receptor.
16	PDB:6z3mP	0.267	0.455	1.045	76	0.101	0.197	6z3mP.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
17	PDB:4cguA	0.159	0.193	1.236	112	0.061	0.080	4cguA.pdb.gz	Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
18	PDB:5n9jZ	0.155	0.188	1.307	119	0.095	0.118	5n9jZ.pdb.gz
19	PDB:2wgpA	0.194	0.176	1.547	168	0.095	0.083	2wgpA.pdb.gz
20	PDB:7w72S	0.174	0.072	1.935	533	0.135	0.038	7w72S.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D2L1	3.90e-108	305	148	1.000	1.000	A4D2L1_HUMAN Receptor (Calcitonin) activity modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=2 SV=1
2	O60896	3.90e-108	305	148	1.000	1.000	RAMP3_HUMAN Receptor activity-modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=1 SV=1
3	J3KR56	8.16e-108	305	151	1.000	0.980	J3KR56_HUMAN Receptor activity modifying protein 3 OS=Homo sapiens OX=9606 GN=RAMP3 PE=1 SV=1
4	Q9JJ73	2.19e-83	243	147	0.764	0.769	RAMP3_RAT Receptor activity-modifying protein 3 OS=Rattus norvegicus OX=10116 GN=Ramp3 PE=2 SV=1
5	Q9WUP1	4.28e-82	239	147	0.757	0.762	RAMP3_MOUSE Receptor activity-modifying protein 3 OS=Mus musculus OX=10090 GN=Ramp3 PE=2 SV=1
6	Q7YS88	1.11e-70	211	151	0.635	0.623	RAMP3_PIG Receptor activity-modifying protein 3 OS=Sus scrofa OX=9823 GN=RAMP3 PE=2 SV=1
7	Q9JJ74	3.86e-28	103	148	0.304	0.304	RAMP1_RAT Receptor activity-modifying protein 1 OS=Rattus norvegicus OX=10116 GN=Ramp1 PE=2 SV=1
8	Q9WTJ5	2.13e-26	99.0	148	0.284	0.284	RAMP1_MOUSE Receptor activity-modifying protein 1 OS=Mus musculus OX=10090 GN=Ramp1 PE=1 SV=1
9	Q867C0	1.31e-25	96.7	148	0.338	0.338	RAMP1_PIG Receptor activity-modifying protein 1 OS=Sus scrofa OX=9823 GN=RAMP1 PE=2 SV=1
10	O60894	5.46e-21	85.1	148	0.318	0.318	RAMP1_HUMAN Receptor activity-modifying protein 1 OS=Homo sapiens OX=9606 GN=RAMP1 PE=1 SV=1
11	Q9WUP0	1.66e-17	77.0	189	0.243	0.190	RAMP2_MOUSE Receptor activity-modifying protein 2 OS=Mus musculus OX=10090 GN=Ramp2 PE=1 SV=1
12	Q9JHJ1	2.27e-17	76.6	182	0.250	0.203	RAMP2_RAT Receptor activity-modifying protein 2 OS=Rattus norvegicus OX=10116 GN=Ramp2 PE=2 SV=1
13	O60895	1.12e-15	72.0	175	0.250	0.211	RAMP2_HUMAN Receptor activity-modifying protein 2 OS=Homo sapiens OX=9606 GN=RAMP2 PE=1 SV=2
14	Q867B9	3.09e-15	70.9	177	0.236	0.198	Q867B9_PIG Receptor activity-modifying protein 2 OS=Sus scrofa OX=9823 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04901 RAMP	8.1e-39	143.4	Receptor activity modifying family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242249

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386972	0.999	Calcitonin gene-related peptide type 1 receptor
2	9606.ENSP00000436607	0.998	ADM
3	9606.ENSP00000352561	0.989	Calcitonin receptor
4	9606.ENSP00000379087	0.986	ADM2
5	9606.ENSP00000240652	0.968	Islet amyloid polypeptide
6	9606.ENSP00000360141	0.962	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
7	9606.ENSP00000331746	0.947	Calcitonin
8	9606.ENSP00000433490	0.943	Calcitonin gene-related peptide 2
9	9606.ENSP00000253796	0.932	Receptor activity-modifying protein 2
10	9606.ENSP00000254661	0.919	Receptor activity-modifying protein 1
11	9606.ENSP00000354896	0.904	Metabotropic glutamate receptor 1
12	9606.ENSP00000019103	0.896	Secretin receptor
13	9606.ENSP00000334448	0.800	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
14	9606.ENSP00000481878	0.800	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
15	9606.ENSP00000420194	0.750	Extracellular calcium-sensing receptor
16	9606.ENSP00000380281	0.744	G-protein coupled estrogen receptor 1
17	9606.ENSP00000366233	0.741	Gamma-aminobutyric acid type B receptor subunit 1
18	9606.ENSP00000259455	0.738	Gamma-aminobutyric acid type B receptor subunit 2
19	9606.ENSP00000393631	0.726	Putative adrenomedullin-5-like protein
20	9606.ENSP00000258770	0.711	Protein TBRG4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015026	1.000	coreceptor activity
GO:0005488	0.988	binding
GO:0005515	0.978	protein binding
GO:0004888	0.950	transmembrane signaling receptor activity
GO:0004930	0.932	G protein-coupled receptor activity
GO:0042277	0.815	peptide binding
GO:0001653	0.718	peptide receptor activity
GO:0008528	0.646	G protein-coupled peptide receptor activity
GO:0097642	0.405	calcitonin family receptor activity
GO:0097643	0.392	amylin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.995	signal transduction
GO:0007186	0.990	G protein-coupled receptor signaling pathway
GO:0007189	0.936	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0048518	0.601	positive regulation of biological process
GO:0032501	0.503	multicellular organismal process
GO:0019222	0.476	regulation of metabolic process
GO:0048522	0.465	positive regulation of cellular process
GO:0060255	0.454	regulation of macromolecule metabolic process
GO:0042221	0.450	response to chemical
GO:0009893	0.421	positive regulation of metabolic process
GO:0010033	0.350	response to organic substance
GO:0051179	0.346	localization
GO:0010604	0.341	positive regulation of macromolecule metabolic process
GO:0048583	0.331	regulation of response to stimulus
GO:0031623	0.326	receptor internalization
GO:0023051	0.323	regulation of signaling
GO:0010646	0.323	regulation of cell communication
GO:1901700	0.313	response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.379	intracellular anatomical structure
GO:0043226	0.352	organelle
GO:0043227	0.319	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]