StarFunc result for job id O60902

User Input

>input (331 residues)
MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDRSSPAVRAAG
GGGGGGGGGGGGGGGGGVGGGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEVSPEL
KDRKEDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLS
EARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGALRMPFQQDSHCNV
TPLSFQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAPPFGLPLATLAADSASAASVV
AAAAAAKTTSKNSSIADLRLKAKKHAAALGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60902	1.000	1.000	6.274E-47	331	1.000	1.000	O60902.pdb.gz	SHOX2_HUMAN Short stature homeobox protein 2 OS=Homo sapiens OX=9606 GN=SHOX2 PE=1 SV=4
2	AFDB:Q7SZN8	0.523	0.570	5.838E-33	299	0.758	0.839	Q7SZN8.pdb.gz	Q7SZN8_DANRE Short stature homeobox 2 OS=Danio rerio OX=7955 GN=zgc:65884 PE=2 SV=1
3	AFDB:A0A024R385	0.303	0.338	2.793E-21	292	0.514	0.582	A0A024R385.pdb.gz
4	AFDB:Q3B7G6	0.245	0.309	6.124E-16	258	0.347	0.446	Q3B7G6.pdb.gz
5	AFDB:Q9Y2V3	0.264	0.254	1.537E-10	346	0.284	0.272	Q9Y2V3.pdb.gz	RX_HUMAN Retinal homeobox protein Rx OS=Homo sapiens OX=9606 GN=RAX PE=1 SV=2
6	AFDB:O35602	0.282	0.274	1.249E-9	342	0.290	0.281	O35602.pdb.gz	RX_MOUSE Retinal homeobox protein Rx OS=Mus musculus OX=10090 GN=Rax PE=2 SV=2
7	AFDB:O42358	0.254	0.284	4.823E-9	292	0.236	0.267	O42358.pdb.gz	RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio OX=7955 GN=rx3 PE=2 SV=1
8	AFDB:Q6QU75	0.270	0.300	5.907E-9	293	0.248	0.280	Q6QU75.pdb.gz	PITX3_DANRE Pituitary homeobox 3 OS=Danio rerio OX=7955 GN=pitx3 PE=2 SV=1
9	AFDB:O42115	0.250	0.189	1.161E-8	453	0.281	0.205	O42115.pdb.gz	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
10	AFDB:O42357	0.267	0.270	1.161E-8	327	0.233	0.235	O42357.pdb.gz	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
11	PDB:4egcA	0.153	0.094	4.773E-3	539	0.045	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.148	0.596	4.148E-2	73	0.057	0.260	2hi3A.pdb.gz
13	PDB:7fbyA	0.116	0.229	7.086E-1	153	0.039	0.085	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.116	0.316	8.678E-1	86	0.036	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:5mrca	0.111	0.197	1.490	177	0.036	0.068	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
16	PDB:1yioA	0.100	0.160	1.825	198	0.027	0.045	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
17	PDB:5fywR	0.108	0.174	2.391	199	0.045	0.075	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
18	PDB:4ldzA	0.125	0.193	2.558	196	0.021	0.036	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
19	PDB:4x6gE	0.093	0.100	2.558	307	0.060	0.065	4x6gE.pdb.gz
20	PDB:2vbwA	0.082	0.169	2.737	147	0.045	0.102	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60902	0.0	672	331	1.000	1.000	SHOX2_HUMAN Short stature homeobox protein 2 OS=Homo sapiens OX=9606 GN=SHOX2 PE=1 SV=4
2	P70390	0.0	653	331	0.985	0.985	SHOX2_MOUSE Short stature homeobox protein 2 OS=Mus musculus OX=10090 GN=Shox2 PE=2 SV=1
3	Q7SZN8	8.02e-151	427	299	0.761	0.843	Q7SZN8_DANRE Short stature homeobox 2 OS=Danio rerio OX=7955 GN=zgc:65884 PE=2 SV=1
4	B0S5T0	4.31e-106	313	285	0.586	0.681	B0S5T0_DANRE Short stature homeobox OS=Danio rerio OX=7955 GN=si:ch211-134k13.1 PE=4 SV=1
5	O15266	9.73e-89	269	292	0.577	0.654	SHOX_HUMAN Short stature homeobox protein OS=Homo sapiens OX=9606 GN=SHOX PE=1 SV=1
6	O42357	2.07e-26	108	327	0.230	0.232	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
7	Q06453	3.22e-25	107	408	0.269	0.218	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
8	O42358	3.64e-25	104	292	0.233	0.264	RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio OX=7955 GN=rx3 PE=2 SV=1
9	A6YP92	2.45e-24	105	566	0.187	0.110	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
10	F1RCT9	2.61e-24	102	280	0.145	0.171	F1RCT9_DANRE Paired mesoderm homeobox protein 2A isoform X1 OS=Danio rerio OX=7955 GN=arix PE=4 SV=1
11	Q6NYV4	2.62e-24	102	277	0.145	0.173	Q6NYV4_DANRE Paired mesoderm homeobox protein 2A OS=Danio rerio OX=7955 GN=arix PE=2 SV=1
12	Q96QS3	2.68e-24	105	562	0.187	0.110	ARX_HUMAN Homeobox protein ARX OS=Homo sapiens OX=9606 GN=ARX PE=1 SV=1
13	O35085	3.84e-24	105	564	0.187	0.110	ARX_MOUSE Homeobox protein ARX OS=Mus musculus OX=10090 GN=Arx PE=1 SV=3
14	Q8T0V5	8.42e-24	102	357	0.142	0.132	Q8T0V5_DROME GH01528p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
15	Q9XZU0	8.50e-24	102	357	0.142	0.132	Q9XZU0_DROME FI01102p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
16	A6NNA5	9.33e-24	100	263	0.133	0.167	DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens OX=9606 GN=DRGX PE=3 SV=1
17	O42115	9.67e-24	103	453	0.145	0.106	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
18	O08934	1.19e-23	103	530	0.139	0.087	UNC4_MOUSE Homeobox protein unc-4 homolog OS=Mus musculus OX=10090 GN=Uncx PE=2 SV=2
19	Q8BYH0	1.19e-23	100	263	0.133	0.167	DRGX_MOUSE Dorsal root ganglia homeobox protein OS=Mus musculus OX=10090 GN=Drgx PE=1 SV=2
20	Q5I7G4	1.68e-23	100	284	0.136	0.158	Q5I7G4_DANRE Paired mesoderm homeobox protein 2B OS=Danio rerio OX=7955 GN=phox2b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	1.2	20.4	Homeobox KN domain
2	PF00046 Homeodomain	4.4e-21	85.8	Homeodomain
3	PF12824 MRP-L20	31	16.2	Mitochondrial ribosomal protein subunit L20
4	PF03826 OAR	0.00011	33.1	OAR motif
5	PF05642 Sporozoite_P67	6.4	16.4	Sporozoite P67 surface antigen

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000008305

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000013408	0.697	T-box 18
2	60711.ENSCSAP00000015694	0.606	T-box 3
3	60711.ENSCSAP00000016824	0.582	Importin 13
4	60711.ENSCSAP00000007820	0.565	Serum response factor (c-fos serum response element-binding transcription factor)
5	60711.ENSCSAP00000010108	0.531	Hyperpolarization activated cyclic nucleotide-gated potassium channel 4
6	60711.ENSCSAP00000016015	0.529	Hyperpolarization activated cyclic nucleotide-gated potassium channel 3
7	60711.ENSCSAP00000006933	0.516	T-box 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:1990837	0.987	sequence-specific double-stranded DNA binding
GO:0000981	0.967	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001217	0.905	DNA-binding transcription repressor activity
GO:0001227	0.900	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000976	0.870	transcription cis-regulatory region binding
GO:0000977	0.681	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.639	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.364	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0048731	0.986	system development
GO:0050794	0.980	regulation of cellular process
GO:0001501	0.931	skeletal system development
GO:0009987	0.909	cellular process
GO:0048522	0.835	positive regulation of cellular process
GO:0048523	0.833	negative regulation of cellular process
GO:0010468	0.722	regulation of gene expression
GO:0048513	0.656	animal organ development
GO:0006355	0.579	regulation of DNA-templated transcription
GO:0007154	0.483	cell communication
GO:0051239	0.440	regulation of multicellular organismal process
GO:0000122	0.427	negative regulation of transcription by RNA polymerase II
GO:0048869	0.409	cellular developmental process
GO:0009888	0.409	tissue development
GO:0010646	0.400	regulation of cell communication
GO:0009653	0.399	anatomical structure morphogenesis
GO:0031328	0.396	positive regulation of cellular biosynthetic process
GO:1902680	0.392	positive regulation of RNA biosynthetic process
GO:0030154	0.388	cell differentiation
GO:0045893	0.384	positive regulation of DNA-templated transcription
GO:0023051	0.344	regulation of signaling
GO:0045944	0.343	positive regulation of transcription by RNA polymerase II
GO:0023052	0.340	signaling
GO:0048598	0.339	embryonic morphogenesis
GO:0050793	0.338	regulation of developmental process
GO:2000026	0.327	regulation of multicellular organismal development
GO:0050896	0.316	response to stimulus
GO:0048583	0.312	regulation of response to stimulus
GO:0065008	0.304	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0005654	0.882	nucleoplasm
GO:0071944	0.522	cell periphery
GO:0005737	0.333	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]