StarFunc result for job id O60907

User Input

>input (577 residues)
MTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFINTSSPRGEAKMSITSDEVN
FLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINED
GTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSA
GVSHQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVEIPSSKATVLRGHESEVFICAW
NPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNTNG
TLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDKTTIIWDAHT
GEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKW
DPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLAS
ASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLV
HSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60907	1.000	1.000	0.000	577	1.000	1.000	O60907.pdb.gz	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
2	AFDB:Q8BHJ5	0.656	0.735	1.827E-92	514	0.787	0.883	Q8BHJ5.pdb.gz	TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus OX=10090 GN=Tbl1xr1 PE=1 SV=1
3	AFDB:Q95RJ9	0.640	0.529	1.578E-71	700	0.646	0.533	Q95RJ9.pdb.gz	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
4	AFDB:Q9FN19	0.619	0.584	1.426E-62	613	0.456	0.429	Q9FN19.pdb.gz	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
5	AFDB:P38262	0.534	0.573	4.475E-34	535	0.225	0.243	P38262.pdb.gz	SIF2_YEAST SIR4-interacting protein SIF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIF2 PE=1 SV=2
6	AFDB:O74845	0.537	0.549	3.428E-32	564	0.211	0.216	O74845.pdb.gz	HIF2_SCHPO Set3 complex subunit hif2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hif2 PE=1 SV=1
7	AFDB:Q9VPR4	0.543	0.639	3.622E-30	488	0.175	0.207	Q9VPR4.pdb.gz	NLE_DROME Protein Notchless OS=Drosophila melanogaster OX=7227 GN=Nle PE=1 SV=2
8	AFDB:Q8RXQ4	0.545	0.765	1.115E-29	407	0.146	0.206	Q8RXQ4.pdb.gz	Q8RXQ4_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At1g71840 PE=1 SV=1
9	AFDB:Q1LV15	0.534	0.737	1.177E-29	415	0.139	0.193	Q1LV15.pdb.gz	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
10	AFDB:Q3Y8L7	0.544	0.698	2.011E-29	446	0.163	0.211	Q3Y8L7.pdb.gz	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
11	PDB:5mzhB	0.537	0.737	8.315E-29	415	0.163	0.227	5mzhB.pdb.gz
12	PDB:7bt6x	0.529	0.623	1.349E-25	488	0.161	0.191	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	PDB:5nnzA	0.528	0.889	2.071E-25	335	0.153	0.263	5nnzA.pdb.gz
14	PDB:1vyhC	0.425	0.748	2.568E-24	310	0.149	0.277	1vyhC.pdb.gz
15	PDB:5jcsq	0.534	0.628	3.736E-24	488	0.163	0.193	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
16	PDB:4v7fq	0.528	0.681	6.734E-24	443	0.154	0.201	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
17	PDB:7mqaLO	0.366	0.262	1.215E-22	819	0.144	0.101	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:2h9lA	0.432	0.734	2.573E-21	321	0.142	0.255	2h9lA.pdb.gz
19	PDB:7vggA	0.435	0.786	4.396E-21	304	0.123	0.234	7vggA.pdb.gz
20	PDB:7mq8LR	0.442	0.337	4.638E-21	773	0.118	0.088	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60907	0.0	1203	577	1.000	1.000	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
2	Q8BHJ5	0.0	939	514	0.787	0.883	TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus OX=10090 GN=Tbl1xr1 PE=1 SV=1
3	Q95RJ9	0.0	638	700	0.511	0.421	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
4	Q9BQ87	0.0	979	522	0.821	0.908	TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens OX=9606 GN=TBL1Y PE=1 SV=1
5	Q9BZK7	0.0	926	514	0.787	0.883	TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1
6	Q9QXE7	0.0	997	527	0.858	0.939	TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus OX=10090 GN=Tbl1x PE=1 SV=2
7	Q9FN19	2.09e-154	458	613	0.374	0.352	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
8	P38262	2.56e-41	159	535	0.237	0.256	SIF2_YEAST SIR4-interacting protein SIF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIF2 PE=1 SV=2
9	Q3Y8L7	6.89e-34	136	446	0.156	0.202	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
10	Q8N136	5.65e-33	132	415	0.163	0.227	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
11	Q9D4T2	3.00e-32	128	304	0.156	0.296	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
12	D3Z7A5	1.03e-31	129	415	0.156	0.217	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
13	Q57W14	1.19e-31	129	419	0.146	0.200	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
14	O74855	4.20e-30	126	502	0.191	0.219	NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsa4 PE=3 SV=1
15	Q1LV15	5.91e-30	124	415	0.153	0.212	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
16	Q8TC44	8.73e-30	124	478	0.142	0.172	POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens OX=9606 GN=POC1B PE=1 SV=1
17	Q99KN2	1.22e-29	121	339	0.151	0.257	CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus OX=10090 GN=Ciao1 PE=1 SV=1
18	O76071	2.91e-29	120	339	0.151	0.257	CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1
19	P61964	2.70e-28	117	334	0.137	0.237	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
20	P61965	2.70e-28	117	334	0.137	0.237	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	4.1e-26	102.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	1.2e-07	43.4	Eukaryotic translation initiation factor eIF2A
3	PF16529 Ge1_WD40	1.3	19.6	WD40 region of Ge1, enhancer of mRNA-decapping protein
4	PF07941 K_channel_TID	11	17.9	Potassium channel Kv1.4 tandem inactivation domain
5	PF08513 LisH	4.1e-06	37.7	LisH
6	PF20426 NBCH_WD40	2.7e-09	47.9	Neurobeachin beta propeller domain
7	PF11715 Nup160	1.9e+02	12.1	Nucleoporin Nup120/160
8	PF07676 PD40	1.8e+02	13.5	WD40-like Beta Propeller Repeat
9	PF14999 Shadoo	2.4e+02	13.2	Shadow of prion protein, neuroprotective
10	PF00400 WD40	1.3e-49	176.3	WD domain, G-beta repeat
11	PF17005 WD40_like	1.6	19.6	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217964

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268712	0.999	Nuclear receptor corepressor 1
2	9606.ENSP00000302967	0.999	Histone deacetylase 3
3	9606.ENSP00000344456	0.999	Catenin beta-1
4	9606.ENSP00000384018	0.999	Nuclear receptor corepressor 2
5	9606.ENSP00000370104	0.997	G protein pathway suppressor 2
6	9606.ENSP00000405574	0.986	F-box-like/WD repeat-containing protein TBL1XR1
7	9606.ENSP00000358151	0.978	Histone H2B type 2-E
8	9606.ENSP00000362649	0.975	Histone deacetylase 1
9	9606.ENSP00000395535	0.972	Methyl-CpG-binding protein 2
10	9606.ENSP00000358404	0.953	Transcription factor 7-like 2
11	9606.ENSP00000338283	0.927	Neuronal PAS domain-containing protein 2
12	9606.ENSP00000365682	0.927	Transducin-like enhancer protein 1
13	9606.ENSP00000301645	0.926	Cholesterol 7-alpha-monooxygenase
14	9606.ENSP00000332194	0.926	Histone H2A type 2-C
15	9606.ENSP00000312379	0.925	Histone-lysine N-methyltransferase 2E
16	9606.ENSP00000362592	0.922	Histone-binding protein RBBP4
17	9606.ENSP00000318820	0.918	Thyroid peroxidase
18	9606.ENSP00000360762	0.918	Ankyrin repeat domain-containing protein 1
19	9606.ENSP00000320147	0.917	Histone-lysine N-methyltransferase EZH2
20	9606.ENSP00000377060	0.916	Chromobox protein homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001067	0.998	transcription regulatory region nucleic acid binding
GO:0003690	0.998	double-stranded DNA binding
GO:0043565	0.996	sequence-specific DNA binding
GO:0140110	0.985	transcription regulator activity
GO:0003712	0.971	transcription coregulator activity
GO:0000976	0.968	transcription cis-regulatory region binding
GO:0003714	0.934	transcription corepressor activity
GO:0042802	0.695	identical protein binding
GO:0042393	0.673	histone binding
GO:0008013	0.518	beta-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0071704	0.980	organic substance metabolic process
GO:0048518	0.980	positive regulation of biological process
GO:0044238	0.976	primary metabolic process
GO:0048522	0.970	positive regulation of cellular process
GO:0009987	0.969	cellular process
GO:0006357	0.935	regulation of transcription by RNA polymerase II
GO:0048519	0.921	negative regulation of biological process
GO:0006807	0.910	nitrogen compound metabolic process
GO:0009893	0.904	positive regulation of metabolic process
GO:0048523	0.897	negative regulation of cellular process
GO:0043170	0.888	macromolecule metabolic process
GO:0051173	0.863	positive regulation of nitrogen compound metabolic process
GO:0010604	0.859	positive regulation of macromolecule metabolic process
GO:0032501	0.852	multicellular organismal process
GO:0031325	0.814	positive regulation of cellular metabolic process
GO:0010557	0.810	positive regulation of macromolecule biosynthetic process
GO:0031328	0.802	positive regulation of cellular biosynthetic process
GO:1902680	0.793	positive regulation of RNA biosynthetic process
GO:1901564	0.776	organonitrogen compound metabolic process
GO:0009966	0.776	regulation of signal transduction
GO:1903508	0.765	positive regulation of nucleic acid-templated transcription
GO:0030111	0.746	regulation of Wnt signaling pathway
GO:0045893	0.743	positive regulation of DNA-templated transcription
GO:0019538	0.725	protein metabolic process
GO:0045944	0.709	positive regulation of transcription by RNA polymerase II
GO:0045892	0.683	negative regulation of DNA-templated transcription
GO:0050896	0.644	response to stimulus
GO:0048584	0.556	positive regulation of response to stimulus
GO:0009967	0.533	positive regulation of signal transduction
GO:0044237	0.484	cellular metabolic process
GO:0006508	0.457	proteolysis
GO:0000122	0.328	negative regulation of transcription by RNA polymerase II
GO:0051716	0.311	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.885	protein-containing complex
GO:0043232	0.465	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]