StarFunc result for job id O60909

User Input

>input (372 residues)
MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASS
SSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLER
VQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYV
INQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIA
MDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD
IRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
DIGRPPSWPPRG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60909	1.000	1.000	2.414E-77	372	1.000	1.000	O60909.pdb.gz	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
2	AFDB:P15535	0.755	0.706	6.092E-51	399	0.538	0.501	P15535.pdb.gz	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
3	AFDB:P08037	0.769	0.714	7.792E-51	402	0.540	0.500	P08037.pdb.gz	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
4	AFDB:P15291	0.751	0.702	7.139E-50	398	0.548	0.513	P15291.pdb.gz	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
5	AFDB:A0A384NY44	0.735	0.696	5.081E-44	393	0.427	0.405	A0A384NY44.pdb.gz	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:B2RAZ5	0.720	0.778	8.925E-42	344	0.398	0.430	B2RAZ5.pdb.gz	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
7	AFDB:Q9GUM2	0.711	0.691	3.946E-39	383	0.317	0.308	Q9GUM2.pdb.gz	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
8	AFDB:Q68EK0	0.601	0.699	1.684E-37	319	0.438	0.511	Q68EK0.pdb.gz
9	AFDB:Q7KN92	0.704	0.651	1.684E-37	403	0.309	0.285	Q7KN92.pdb.gz	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
10	AFDB:Q3YL68	0.702	0.685	1.066E-36	381	0.360	0.352	Q3YL68.pdb.gz	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
11	PDB:4fixA	0.326	0.203	6.834E-5	629	0.075	0.045	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
12	PDB:6pxuB	0.362	0.264	9.885E-5	532	0.105	0.073	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
13	PDB:1ll0B	0.262	0.341	4.328E-4	267	0.094	0.131	1ll0B.pdb.gz
14	PDB:6h0bB	0.332	0.244	5.206E-4	521	0.091	0.065	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
15	PDB:4d0tA	0.320	0.246	1.024E-3	496	0.081	0.060	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
16	PDB:2d7iA	0.344	0.247	1.159E-3	536	0.089	0.062	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
17	PDB:6iwqA	0.272	0.194	2.280E-3	546	0.086	0.059	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
18	PDB:6fxrA	0.318	0.184	2.916E-3	700	0.067	0.036	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
19	PDB:4d11C	0.348	0.300	3.729E-3	436	0.075	0.064	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
20	PDB:7jhiC	0.279	0.308	5.395E-3	331	0.078	0.088	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60909	0.0	768	372	1.000	1.000	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
2	Q9Z2Y2	0.0	692	369	0.919	0.927	B4GT2_MOUSE Beta-1,4-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B4galt2 PE=2 SV=1
3	P15291	2.73e-139	404	398	0.554	0.518	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
4	P15535	9.17e-138	400	399	0.548	0.511	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
5	P08037	5.81e-137	398	402	0.548	0.507	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
6	Q99PC2	5.50e-136	395	393	0.540	0.511	Q99PC2_CRIGR Beta-1,4-galactosyltransferase OS=Cricetulus griseus OX=10029 GN=beta4GalT-1 PE=2 SV=1
7	B2RAZ5	1.92e-94	287	344	0.368	0.398	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
8	O60513	1.92e-94	287	344	0.368	0.398	B4GT4_HUMAN Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1
9	A0A384NY44	1.43e-91	281	393	0.406	0.384	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
10	O60512	1.43e-91	281	393	0.406	0.384	B4GT3_HUMAN Beta-1,4-galactosyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALT3 PE=1 SV=2
11	Q9GUM2	3.95e-81	254	383	0.317	0.308	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
12	Q3YL68	2.19e-79	250	381	0.339	0.331	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
13	Q802Y5	2.84e-79	249	381	0.368	0.360	Q802Y5_DANRE Beta-1,4-galactosyltransferase OS=Danio rerio OX=7955 GN=zgc:55730 PE=2 SV=1
14	Q9JMK0	1.43e-75	240	388	0.347	0.332	B4GT5_MOUSE Beta-1,4-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B4galt5 PE=1 SV=2
15	Q7KN92	3.16e-73	235	403	0.315	0.290	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
16	Q9UBX8	1.05e-72	233	382	0.339	0.330	B4GT6_HUMAN Beta-1,4-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B4GALT6 PE=1 SV=1
17	O43286	2.14e-72	232	388	0.333	0.320	B4GT5_HUMAN Beta-1,4-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B4GALT5 PE=1 SV=1
18	A0A1S6M251	3.05e-72	232	388	0.331	0.317	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
19	O88419	3.80e-72	231	382	0.341	0.332	B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus OX=10116 GN=B4galt6 PE=1 SV=1
20	Q9WVK5	1.24e-71	230	382	0.341	0.332	B4GT6_MOUSE Beta-1,4-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B4galt6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10111 Glyco_tranf_2_2	22	16.0	Glycosyltransferase like family 2
2	PF02709 Glyco_transf_7C	2.2e-27	105.9	N-terminal domain of galactosyltransferase
3	PF13733 Glyco_transf_7N	1.5e-52	188.2	N-terminal region of glycosyl transferase group 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310696

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343924	0.975	Prolargin
2	9606.ENSP00000262915	0.972	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
3	9606.ENSP00000353910	0.969	Alpha-(1,6)-fucosyltransferase
4	9606.ENSP00000319636	0.966	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
5	9606.ENSP00000386942	0.960	Beta-galactoside alpha-2,6-sialyltransferase 2
6	9606.ENSP00000305595	0.959	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
7	9606.ENSP00000376456	0.959	Beta-1,3-galactosyltransferase 1
8	9606.ENSP00000381699	0.951	Beta-1,3-galactosyltransferase 5
9	9606.ENSP00000316173	0.949	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
10	9606.ENSP00000169298	0.948	Beta-galactoside alpha-2,6-sialyltransferase 1
11	9606.ENSP00000391227	0.944	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
12	9606.ENSP00000230053	0.941	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2
13	9606.ENSP00000302599	0.941	Alpha-(1,3)-fucosyltransferase 9
14	9606.ENSP00000312021	0.940	Galactoside 2-alpha-L-fucosyltransferase 1
15	9606.ENSP00000436047	0.939	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
16	9606.ENSP00000321874	0.936	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
17	9606.ENSP00000356404	0.935	Beta-1,3-galactosyltransferase 2
18	9606.ENSP00000313398	0.932	Alpha-(1,3)-fucosyltransferase 6
19	9606.ENSP00000480884	0.931	Type 2 lactosamine alpha-2,3-sialyltransferase
20	9606.ENSP00000361060	0.921	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008194	1.000	UDP-glycosyltransferase activity
GO:0008378	1.000	galactosyltransferase activity
GO:0035250	0.981	UDP-galactosyltransferase activity
GO:0140096	0.546	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0009987	0.986	cellular process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.973	cellular metabolic process
GO:0006807	0.951	nitrogen compound metabolic process
GO:1901564	0.941	organonitrogen compound metabolic process
GO:1901576	0.936	organic substance biosynthetic process
GO:1901135	0.905	carbohydrate derivative metabolic process
GO:0044249	0.905	cellular biosynthetic process
GO:1901137	0.894	carbohydrate derivative biosynthetic process
GO:0032501	0.891	multicellular organismal process
GO:1901566	0.887	organonitrogen compound biosynthetic process
GO:0007610	0.679	behavior
GO:0043170	0.601	macromolecule metabolic process
GO:0019538	0.555	protein metabolic process
GO:0009100	0.488	glycoprotein metabolic process
GO:0070085	0.449	glycosylation
GO:0009059	0.441	macromolecule biosynthetic process
GO:0009311	0.414	oligosaccharide metabolic process
GO:0016051	0.413	carbohydrate biosynthetic process
GO:0009101	0.411	glycoprotein biosynthetic process
GO:0036211	0.389	protein modification process
GO:0006486	0.364	protein glycosylation
GO:0032502	0.317	developmental process
GO:0007275	0.306	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.996	Golgi membrane
GO:0070013	0.922	intracellular organelle lumen
GO:0031981	0.698	nuclear lumen
GO:0005576	0.697	extracellular region
GO:0005654	0.648	nucleoplasm
GO:0005615	0.572	extracellular space
GO:1903561	0.334	extracellular vesicle
GO:0070062	0.322	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]