StarFunc result for job id O60911

User Input

>input (334 residues)
MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIE
LHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDW
RKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNG
GFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAV
ATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVK
NSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60911	1.000	1.000	1.671E-73	334	1.000	1.000	O60911.pdb.gz	CATL2_HUMAN Cathepsin L2 OS=Homo sapiens OX=9606 GN=CTSV PE=1 SV=2
2	AFDB:A0A024R276	0.952	0.955	4.587E-62	333	0.772	0.775	A0A024R276.pdb.gz
3	AFDB:P25975	0.946	0.946	7.445E-62	334	0.796	0.796	P25975.pdb.gz	CATL1_BOVIN Procathepsin L OS=Bos taurus OX=9913 GN=CTSL PE=1 SV=3
4	AFDB:P06797	0.984	0.984	3.184E-61	334	0.751	0.751	P06797.pdb.gz	CATL1_MOUSE Procathepsin L OS=Mus musculus OX=10090 GN=Ctsl PE=1 SV=2
5	PDB:1cs8A	0.923	0.975	3.371E-57	316	0.728	0.769	1cs8A.pdb.gz
6	AFDB:B9EP08	0.956	0.945	2.965E-55	338	0.626	0.618	B9EP08.pdb.gz	B9EP08_SALSA Cathepsin L1 OS=Salmo salar OX=8030 GN=CATL1 PE=2 SV=1
7	AFDB:F1R7B3	0.940	0.892	4.804E-54	352	0.599	0.568	F1R7B3.pdb.gz	F1R7B3_DANRE Cathepsin Lb OS=Danio rerio OX=7955 GN=catL PE=3 SV=1
8	AFDB:P15242	0.934	0.937	2.954E-53	333	0.614	0.616	P15242.pdb.gz	TEST2_RAT Testin-2 OS=Rattus norvegicus OX=10116 GN=Testin PE=1 SV=2
9	AFDB:Q9JI81	0.922	0.924	3.323E-51	333	0.563	0.565	Q9JI81.pdb.gz	CAT8_MOUSE Cathepsin 8 OS=Mus musculus OX=10090 GN=Cts8 PE=2 SV=1
10	AFDB:Q63088	0.917	0.917	3.964E-48	334	0.530	0.530	Q63088.pdb.gz	CATJ_RAT Cathepsin J OS=Rattus norvegicus OX=10116 GN=Ctsj PE=2 SV=2
11	AFDB:Q95029	0.894	0.806	6.835E-48	371	0.494	0.445	Q95029.pdb.gz	CATL_DROME Cathepsin L OS=Drosophila melanogaster OX=7227 GN=Cp1 PE=2 SV=2
12	PDB:7pckA	0.895	0.951	8.197E-46	314	0.488	0.519	7pckA.pdb.gz
13	PDB:2c0yA	0.873	0.945	6.812E-44	308	0.479	0.519	2c0yA.pdb.gz
14	PDB:2o6xA	0.866	0.944	9.106E-37	306	0.404	0.441	2o6xA.pdb.gz
15	PDB:5egwA	0.792	0.732	5.907E-32	363	0.350	0.322	5egwA.pdb.gz
16	PDB:3tnxA	0.816	0.876	3.853E-30	310	0.338	0.365	3tnxA.pdb.gz
17	PDB:2pnsA	0.600	0.956	3.594E-25	208	0.308	0.495	2pnsA.pdb.gz
18	PDB:1o0eA	0.601	0.957	5.491E-25	208	0.305	0.490	1o0eA.pdb.gz
19	PDB:2bdzA	0.582	0.907	1.004E-23	212	0.293	0.462	2bdzA.pdb.gz	Purification, crystallization and preliminary X-ray analysis of Mexicain
20	PDB:1jqpA	0.588	0.565	2.199E-21	348	0.249	0.239	1jqpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60911	0.0	700	334	1.000	1.000	CATL2_HUMAN Cathepsin L2 OS=Homo sapiens OX=9606 GN=CTSV PE=1 SV=2
2	P06797	0.0	524	334	0.751	0.751	CATL1_MOUSE Procathepsin L OS=Mus musculus OX=10090 GN=Ctsl PE=1 SV=2
3	P07154	0.0	528	334	0.740	0.740	CATL1_RAT Procathepsin L OS=Rattus norvegicus OX=10116 GN=Ctsl PE=1 SV=2
4	P07711	0.0	550	333	0.772	0.775	CATL1_HUMAN Procathepsin L OS=Homo sapiens OX=9606 GN=CTSL PE=1 SV=2
5	P25975	0.0	565	334	0.796	0.796	CATL1_BOVIN Procathepsin L OS=Bos taurus OX=9913 GN=CTSL PE=1 SV=3
6	Q9GKL8	0.0	550	333	0.775	0.778	CATL1_CHLAE Procathepsin L OS=Chlorocebus aethiops OX=9534 GN=CTSL PE=2 SV=1
7	B9EP08	1.13e-163	461	338	0.635	0.627	B9EP08_SALSA Cathepsin L1 OS=Salmo salar OX=8030 GN=CATL1 PE=2 SV=1
8	C0H7V2	1.58e-162	459	338	0.632	0.624	C0H7V2_SALSA Cathepsin L1 OS=Salmo salar OX=8030 GN=CATL1 PE=2 SV=1
9	Q5T8F0	4.51e-151	427	272	0.605	0.743	Q5T8F0_HUMAN Cathepsin L OS=Homo sapiens OX=9606 GN=CTSL PE=1 SV=2
10	A7MCR7	5.66e-151	429	336	0.596	0.592	A7MCR7_DANRE Cathepsin Lb OS=Danio rerio OX=7955 GN=ctslb PE=1 SV=1
11	A8E587	1.71e-150	428	336	0.596	0.592	A8E587_DANRE Cathepsin L1-like precursor OS=Danio rerio OX=7955 GN=MGC174152 PE=2 SV=1
12	P79722	2.35e-150	427	336	0.596	0.592	P79722_DANRE Cathepsin L OS=Danio rerio OX=7955 GN=catL PE=2 SV=1
13	A7MCR8	2.53e-150	427	335	0.599	0.597	A7MCR8_DANRE Cathepsin L1-like precursor OS=Danio rerio OX=7955 GN=ctslb PE=1 SV=1
14	F1R7B3	4.30e-150	427	352	0.596	0.565	F1R7B3_DANRE Cathepsin Lb OS=Danio rerio OX=7955 GN=catL PE=3 SV=1
15	A7MCM3	7.88e-150	426	335	0.599	0.597	A7MCM3_DANRE Cathepsin L1-like OS=Danio rerio OX=7955 GN=MGC174155 PE=2 SV=1
16	P15242	1.21e-148	423	333	0.611	0.613	TEST2_RAT Testin-2 OS=Rattus norvegicus OX=10116 GN=Testin PE=1 SV=2
17	Q9JI81	5.60e-136	391	333	0.563	0.565	CAT8_MOUSE Cathepsin 8 OS=Mus musculus OX=10090 GN=Cts8 PE=2 SV=1
18	Q10991	3.21e-133	380	217	0.545	0.839	CATL1_SHEEP Procathepsin L OS=Ovis aries OX=9940 GN=CTSL PE=1 SV=1
19	Q63088	1.96e-128	372	334	0.530	0.530	CATJ_RAT Cathepsin J OS=Rattus norvegicus OX=10116 GN=Ctsj PE=2 SV=2
20	Q91ZF2	1.75e-118	347	331	0.515	0.520	CAT7_MOUSE Cathepsin 7 OS=Mus musculus OX=10090 GN=Cts7 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08246 Inhibitor_I29	1.1e-08	46.6	Cathepsin propeptide inhibitor domain (I29)
2	PF00112 Peptidase_C1	1.3e-82	288.7	Papain family cysteine protease
3	PF03051 Peptidase_C1_2	0.009	26.5	Peptidase C1-like family
4	PF17562 Styelin	44	15.8	Styelin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445052

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000408146	0.927	HLA class II histocompatibility antigen, DP beta 1 chain
2	9606.ENSP00000347665	0.918	Collagen alpha-1(XVIII) chain
3	9606.ENSP00000378786	0.906	HLA class II histocompatibility antigen, DR alpha chain
4	9606.ENSP00000393566	0.906	HLA class II histocompatibility antigen, DP alpha 1 chain
5	9606.ENSP00000009530	0.904	HLA class II histocompatibility antigen gamma chain
6	9606.ENSP00000353099	0.904	HLA class II histocompatibility antigen, DRB1-15 beta chain
7	9606.ENSP00000364080	0.904	HLA class II histocompatibility antigen, DQ beta 1 chain
8	9606.ENSP00000364114	0.904	HLA class II histocompatibility antigen, DR beta 5 chain
9	9606.ENSP00000390431	0.904	Major histocompatibility complex, class II, DQ beta 2
10	9606.ENSP00000364140	0.903	Collagen alpha-1(XV) chain
11	9606.ENSP00000339398	0.901	Major histocompatibility complex, class II, DQ alpha 1
12	9606.ENSP00000364076	0.901	HLA class II histocompatibility antigen, DQ alpha 2 chain
13	9606.ENSP00000264474	0.889	Cystatin-A
14	9606.ENSP00000345344	0.819	Cathepsin L1
15	9606.ENSP00000324248	0.706	Proenkephalin-A
16	9606.ENSP00000429969	0.683	Signal peptide, CUB domain and EGF like domain containing 2
17	9606.ENSP00000341584	0.682	Serpin B13
18	9606.ENSP00000366273	0.670	Zinc finger protein 157
19	9606.ENSP00000271651	0.664	Cathepsin K
20	9606.ENSP00000236671	0.660	Cathepsin D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004197	0.999	cysteine-type endopeptidase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0002504	0.923	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0002478	0.913	antigen processing and presentation of exogenous peptide antigen
GO:0019886	0.890	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0065007	0.822	biological regulation
GO:0030198	0.766	extracellular matrix organization
GO:0022617	0.683	extracellular matrix disassembly
GO:0008152	0.679	metabolic process
GO:0043170	0.659	macromolecule metabolic process
GO:0006807	0.650	nitrogen compound metabolic process
GO:0044238	0.611	primary metabolic process
GO:0050789	0.607	regulation of biological process
GO:1901564	0.601	organonitrogen compound metabolic process
GO:0019538	0.568	protein metabolic process
GO:0050896	0.566	response to stimulus
GO:0050794	0.536	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005576	0.998	extracellular region
GO:0070013	0.995	intracellular organelle lumen
GO:0005773	0.968	vacuole
GO:0000323	0.902	lytic vacuole
GO:0012505	0.899	endomembrane system
GO:0031982	0.842	vesicle
GO:0005764	0.782	lysosome
GO:0005615	0.626	extracellular space
GO:0016020	0.576	membrane
GO:0031981	0.373	nuclear lumen
GO:0031410	0.337	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	0.999	Cysteine endopeptidases.

[back to server]