StarFunc result for job id O60925

User Input

>input (122 residues)
MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNM
YEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARR
AQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60925	1.000	1.000	1.398E-17	122	1.000	1.000	O60925.pdb.gz	PFD1_HUMAN Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2
2	AFDB:Q17827	0.913	0.951	4.197E-8	117	0.303	0.316	Q17827.pdb.gz	PFD1_CAEEL Probable prefoldin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=pfd-1 PE=2 SV=1
3	AFDB:Q94AF7	0.817	0.782	4.197E-8	128	0.328	0.312	Q94AF7.pdb.gz	PFD1_ARATH Prefoldin subunit 1 OS=Arabidopsis thaliana OX=3702 GN=PFD1 PE=1 SV=1
4	PDB:2zdiB	0.732	0.832	2.236E-5	106	0.205	0.236	2zdiB.pdb.gz
5	AFDB:O14334	0.774	0.838	2.612E-5	112	0.197	0.214	O14334.pdb.gz	PFD1_SCHPO Probable prefoldin subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1D7.01 PE=3 SV=1
6	AFDB:O58268	0.754	0.782	2.963E-5	117	0.221	0.231	O58268.pdb.gz	PFDB_PYRHO Prefoldin subunit beta OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=pfdB PE=1 SV=1
7	AFDB:P46988	0.734	0.814	6.315E-5	109	0.221	0.248	P46988.pdb.gz	PFD1_YEAST Prefoldin subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFD1 PE=1 SV=2
8	AFDB:O14450	0.766	0.816	1.046E-4	114	0.139	0.149	O14450.pdb.gz	PFD6_SCHPO Probable prefoldin subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3A11.13 PE=3 SV=1
9	AFDB:P52554	0.729	0.709	1.965E-4	126	0.115	0.111	P52554.pdb.gz	PFD6_CAEEL Probable prefoldin subunit 6 OS=Caenorhabditis elegans OX=6239 GN=pfd-6 PE=2 SV=1
10	AFDB:O15212	0.715	0.681	5.062E-4	129	0.148	0.140	O15212.pdb.gz	PFD6_HUMAN Prefoldin subunit 6 OS=Homo sapiens OX=9606 GN=PFDN6 PE=1 SV=1
11	AFDB:Q2HIK4	0.686	0.655	1.304E-3	129	0.139	0.132	Q2HIK4.pdb.gz	PFD6_ARATH Prefoldin subunit 6 OS=Arabidopsis thaliana OX=3702 GN=PFD6 PE=1 SV=1
12	PDB:2zdiC	0.692	0.587	1.791E-2	148	0.197	0.162	2zdiC.pdb.gz
13	PDB:6tuyA	0.655	0.131	1.348E-1	667	0.139	0.025	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
14	PDB:6s1kE	0.690	0.810	1.435E-1	102	0.098	0.118	6s1kE.pdb.gz
15	PDB:7aqcR	0.513	0.141	1.967E-1	558	0.082	0.018	7aqcR.pdb.gz	Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
16	PDB:7ungC4	0.380	0.226	3.471E-1	219	0.131	0.073	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:4l87A	0.552	0.158	4.194E-1	476	0.172	0.044	4l87A.pdb.gz	Crystal Structure of Human Seryl-tRNA Synthetase and Ser-SA Complex Reveals a Molecular Lever Specific to Higher Eukaryotes.
18	PDB:7khwA	0.452	0.361	4.194E-1	174	0.066	0.046	7khwA.pdb.gz
19	PDB:2b5uA	0.599	0.188	4.758E-1	470	0.107	0.028	2b5uA.pdb.gz
20	PDB:6z6oC	0.551	0.151	5.067E-1	548	0.164	0.036	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60925	4.73e-84	243	122	1.000	1.000	PFD1_HUMAN Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2
2	Q3SZE2	2.62e-83	241	122	0.984	0.984	PFD1_BOVIN Prefoldin subunit 1 OS=Bos taurus OX=9913 GN=PFDN1 PE=2 SV=1
3	Q9CWM4	7.00e-81	234	122	0.967	0.967	PFD1_MOUSE Prefoldin subunit 1 OS=Mus musculus OX=10090 GN=Pfdn1 PE=1 SV=1
4	Q94AF7	9.54e-16	70.1	128	0.320	0.305	PFD1_ARATH Prefoldin subunit 1 OS=Arabidopsis thaliana OX=3702 GN=PFD1 PE=1 SV=1
5	Q17827	1.05e-11	59.3	117	0.336	0.350	PFD1_CAEEL Probable prefoldin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=pfd-1 PE=2 SV=1
6	P46988	7.99e-04	38.5	109	0.213	0.239	PFD1_YEAST Prefoldin subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFD1 PE=1 SV=2
7	O14334	8.46e-04	38.5	112	0.197	0.214	PFD1_SCHPO Probable prefoldin subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1D7.01 PE=3 SV=1
8	O35462	0.010	36.6	496	0.279	0.069	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
9	Q38EM6	0.038	35.0	1690	0.131	0.009	Q38EM6_TRYB2 Adenosine monophosphate deaminase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5250 PE=3 SV=1
10	Q16363	0.26	32.7	1823	0.246	0.016	LAMA4_HUMAN Laminin subunit alpha-4 OS=Homo sapiens OX=9606 GN=LAMA4 PE=1 SV=4
11	O58268	2.7	28.9	117	0.172	0.179	PFDB_PYRHO Prefoldin subunit beta OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=pfdB PE=1 SV=1
12	O35608	2.8	29.6	496	0.246	0.060	ANGP2_MOUSE Angiopoietin-2 OS=Mus musculus OX=10090 GN=Angpt2 PE=2 SV=2
13	O43824	3.0	29.6	516	0.270	0.064	GTPB6_HUMAN Putative GTP-binding protein 6 OS=Homo sapiens OX=9606 GN=GTPBP6 PE=1 SV=4
14	Q57W46	3.6	29.3	1315	0.131	0.012	Q57W46_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.310 PE=4 SV=1
15	Q10172	4.7	28.9	1794	0.172	0.012	PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan1 PE=1 SV=1
16	Q4AC22	6.8	28.5	4149	0.172	0.005	Q4AC22_CHLRE Dynein heavy chain 9 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC9 PE=1 SV=3
17	P08249	7.0	28.5	338	0.205	0.074	MDHM_MOUSE Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3
18	P52016	7.4	28.5	447	0.107	0.029	CYP8_CAEEL Peptidyl-prolyl cis-trans isomerase 8 OS=Caenorhabditis elegans OX=6239 GN=cyn-8 PE=2 SV=2
19	Q6PB44	7.8	28.5	1692	0.123	0.009	PTN23_MOUSE Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus OX=10090 GN=Ptpn23 PE=1 SV=2
20	Q9QXU8	9.0	28.1	523	0.139	0.033	DC1L1_RAT Cytoplasmic dynein 1 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1li1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06401 Alpha-2-MRAP_C	36	15.8	Alpha-2-macroglobulin RAP, C-terminal domain
2	PF06810 Phage_GP20	3e+02	12.6	Phage minor structural protein GP20
3	PF01920 Prefoldin_2	1.6e-17	74.8	Prefoldin subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286428	0.999	Prefoldin subunit 3
2	9606.ENSP00000356989	0.999	Prefoldin subunit 2
3	9606.ENSP00000360473	0.999	Prefoldin subunit 4
4	9606.ENSP00000378563	0.999	Prefoldin subunit 6
5	9606.ENSP00000447942	0.999	Prefoldin subunit 5
6	9606.ENSP00000317334	0.975	T-complex protein 1 subunit alpha
7	9606.ENSP00000299300	0.967	T-complex protein 1 subunit beta
8	9606.ENSP00000286788	0.956	T-complex protein 1 subunit theta
9	9606.ENSP00000377958	0.956	T-complex protein 1 subunit delta
10	9606.ENSP00000280326	0.953	T-complex protein 1 subunit epsilon
11	9606.ENSP00000295688	0.951	T-complex protein 1 subunit gamma
12	9606.ENSP00000258091	0.949	T-complex protein 1 subunit eta
13	9606.ENSP00000275603	0.944	T-complex protein 1 subunit zeta
14	9606.ENSP00000250495	0.865	NEDD8
15	9606.ENSP00000349960	0.806	Actin, cytoplasmic 1
16	9606.ENSP00000431482	0.793	NEDD8-MDP1 readthrough
17	9606.ENSP00000301071	0.756	Tubulin alpha-1A chain
18	9606.ENSP00000225655	0.746	Profilin-1
19	9606.ENSP00000416706	0.739	Beta-actin-like protein 2
20	9606.ENSP00000414359	0.712	Proteasome subunit alpha type-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051082	1.000	unfolded protein binding
GO:0044183	0.999	protein folding chaperone
GO:0001540	0.998	amyloid-beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.966	regulation of cellular process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0048519	0.927	negative regulation of biological process
GO:0048523	0.922	negative regulation of cellular process
GO:0051128	0.915	regulation of cellular component organization
GO:0006457	0.897	protein folding
GO:0080090	0.884	regulation of primary metabolic process
GO:0051171	0.884	regulation of nitrogen compound metabolic process
GO:1902903	0.814	regulation of supramolecular fiber organization
GO:0071840	0.796	cellular component organization or biogenesis
GO:0051129	0.656	negative regulation of cellular component organization
GO:0051246	0.571	regulation of protein metabolic process
GO:0010605	0.515	negative regulation of macromolecule metabolic process
GO:0016043	0.502	cellular component organization
GO:0051172	0.482	negative regulation of nitrogen compound metabolic process
GO:0031323	0.432	regulation of cellular metabolic process
GO:0051248	0.383	negative regulation of protein metabolic process
GO:1902904	0.380	negative regulation of supramolecular fiber organization
GO:0032502	0.351	developmental process
GO:0048856	0.343	anatomical structure development
GO:0008152	0.321	metabolic process
GO:0032501	0.317	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005829	0.993	cytosol
GO:0032991	0.981	protein-containing complex
GO:0043231	0.818	intracellular membrane-bounded organelle
GO:0031981	0.593	nuclear lumen
GO:0005654	0.555	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]